Align ABC transporter for D-Cellobiose and D-Salicin, permease component 1 (characterized)
to candidate HSERO_RS01335 HSERO_RS01335 sugar ABC transporter permease
Query= reanno::Smeli:SMc04257 (305 letters) >FitnessBrowser__HerbieS:HSERO_RS01335 Length = 283 Score = 160 bits (404), Expect = 4e-44 Identities = 86/272 (31%), Positives = 154/272 (56%), Gaps = 9/272 (3%) Query: 35 TLIVVALYYLLPLYVMIVTSLKGMPEIRVGNIFAPPLEITFEPWVKAWAEACTGLNCDGL 94 +L V L +LLP+ +VTS++ E+ GN + P + ++ + EA T + Sbjct: 20 SLPVALLIWLLPMLAALVTSIRSNDELMAGNYWGWPQDFAM---LENYREALTA---SPM 73 Query: 95 SRGFWNSVRITVPSVIISIAIASVNGYALANWRFKGADLFFTILIVGAFIPYQVMIYPIV 154 FWNS IT+PSVI +I++A++ G+AL+ ++F+G + F + F+P Q+++ P+ Sbjct: 74 LHYFWNSCLITIPSVIGAISLAAMAGFALSTYQFRGNTVLFATFVACNFVPQQILMIPVR 133 Query: 155 IVLREMGVYGTLTGLIIVHTIFGMPILTLLFRNYFAGLPEELFKAARVDGAGFWTIYFKI 214 + +G++ T+TG+++ H TL RN+ LP E+ +AAR++GA WT++++I Sbjct: 134 DLSLSLGLFNTITGMMLFHIAMQTGFCTLFLRNFIKQLPFEMIEAARIEGASEWTVFYRI 193 Query: 215 MLPMSLPIFVVAMILQVTGIWNDFLFGVVFTR-PEYYPMTVQLNNIVNSVQGVKEYNVNM 273 +LP+ P +L T +WND+ + +V T+ + P+TV + + Q +N+ Sbjct: 194 VLPLIRPALAALAVLVFTFVWNDYFWALVLTQGDDVAPITVGVAALRG--QWTTAWNLVS 251 Query: 274 AATILTGLVPLTVYFVSGRLFVRGIAAGAVKG 305 A +IL L + ++FV + FV G+ GA KG Sbjct: 252 AGSILAALPSVILFFVMQKQFVAGLTFGASKG 283 Lambda K H 0.329 0.145 0.450 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 234 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 305 Length of database: 283 Length adjustment: 26 Effective length of query: 279 Effective length of database: 257 Effective search space: 71703 Effective search space used: 71703 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory