Align TM0028, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized)
to candidate HSERO_RS15940 HSERO_RS15940 peptide ABC transporter substrate-binding protein
Query= TCDB::Q9WXN5 (330 letters) >FitnessBrowser__HerbieS:HSERO_RS15940 Length = 334 Score = 176 bits (445), Expect = 1e-48 Identities = 105/315 (33%), Positives = 178/315 (56%), Gaps = 14/315 (4%) Query: 4 ILLKAENVRAYYKLEKVSVKAVDGLSFEILEDEVIGVVGESGCGKTTLSNVIFMNMV--K 61 +LL +N++ E + AV G+ F++ E++ +VGESGCGK+ ++++ M ++ K Sbjct: 3 VLLDVKNLKVDLPTENGMLHAVRGIDFQVRRGEMLCLVGESGCGKS-MTSLALMGLLPRK 61 Query: 62 PLTLVDGKIFLRVNGEFVELSSMTRDEVKRKFWGKEITIIPQAAMNALMPTIRM-EKYVR 120 D +F + V+L M D+ + GK + +I Q M +L P+ + + Sbjct: 62 AQCSADHILF-----DGVDLHGMP-DKQLMQLRGKRMAMIFQEPMTSLNPSYTLGNQLCE 115 Query: 121 HLAESHGIDEEELLDKARRRFEEVGLDPLW--IKRYPFELSGGMRQRAVIAIATILNPSL 178 + + G+ E ++A G+ +++YP +LSGG+RQR +IA++ + NP L Sbjct: 116 AMLQQPGVSRAEARERALYLLHRTGISNAEDRLRQYPHQLSGGLRQRVMIAMSLMCNPDL 175 Query: 179 LIADEPTSALDVVNQKVLLKVLMQMKRQGIVKSIIFITHDIATVRQIADRMIIMYAGKIV 238 +IADEPT+ALDV Q +L+++ +++++ ++IFITHD+ V +IADR+ +MYAG++V Sbjct: 176 IIADEPTTALDVTIQAQILRMIRELQQE-FGAAVIFITHDLGVVSRIADRVAVMYAGQVV 234 Query: 239 EFAPVESLLEKPLHPYTQGLFNSVLTPEPEVKKRGITTIPGAPPNLINPPSGCRFHPRCP 298 E V L +P HPYTQGL N + + + IPG P+L+ SGC F RC Sbjct: 235 ETTDVAQLFAQPRHPYTQGLLNCIPVRGKTLPGSHLQAIPGVVPSLVGQVSGCAFRNRCA 294 Query: 299 HAMDVCKEKEPPLTE 313 A C E++P + + Sbjct: 295 KADSGC-ERDPQMVQ 308 Lambda K H 0.321 0.138 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 250 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 330 Length of database: 334 Length adjustment: 28 Effective length of query: 302 Effective length of database: 306 Effective search space: 92412 Effective search space used: 92412 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory