Align CbtF, component of Cellobiose and cellooligosaccharide porter (characterized)
to candidate HSERO_RS15935 HSERO_RS15935 ABC transporter ATP-binding protein
Query= TCDB::Q97VF4 (324 letters) >FitnessBrowser__HerbieS:HSERO_RS15935 Length = 280 Score = 162 bits (409), Expect = 1e-44 Identities = 101/263 (38%), Positives = 160/263 (60%), Gaps = 13/263 (4%) Query: 4 MELKGVSVIFEDKVGLFKKR-KFYALKDVSLSMNQGDLLIVLGESGAGKTTLGRVIVGLQ 62 +EL ++ ++ K GLF+ + A+ DVSL + +G+ L ++GESG GK+TL ++++GL Sbjct: 16 LELCALTKVYPLKRGLFQPPGQLKAVNDVSLRLYRGETLGLVGESGCGKSTLAKMLLGLL 75 Query: 63 KPTSGEVVYDGYNIWKNKRKIFKKYRKDVQLIPQDPYSTLPFNKTVEEILVAPILRWEKI 122 PTSG V+ +G + +RK ++ +Q I QDPYS+L KTV EI+ P+ Sbjct: 76 PPTSGNVLINGQEVDPTERKAHARH---IQPIFQDPYSSLNPRKTVAEIVGLPLKLHGIG 132 Query: 123 NKDELRKRLINLLELVKLTPAEEFLGKYPHQLSGGQKQRLSIARSLSVNPRIIVADEPVT 182 N E +++ ++L+LV + E +YP+QLSGGQ+QR++IAR+L + P I++ DEP + Sbjct: 133 NAAERNRQVKDILDLVGMP--ERTHAQYPNQLSGGQRQRVAIARALILRPDILICDEPTS 190 Query: 183 MVDASLRIGILNTLAEIKNRLNLTMVFITHDIPIARYFYHLFDKGNTIVMFAGRIVERAD 242 +D S++ ILN L ++K LT +FI+HD+ + HL D+ VM G IVE Sbjct: 191 ALDVSVQAQILNLLLDLKAEFGLTYLFISHDLGVVE---HLVDR--VAVMNQGSIVELQS 245 Query: 243 LEEILKDPLHPYTNDLI--KLTP 263 E++ +P H YT L+ LTP Sbjct: 246 REQLFSEPQHLYTRMLLASALTP 268 Lambda K H 0.321 0.141 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 225 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 280 Length adjustment: 27 Effective length of query: 297 Effective length of database: 253 Effective search space: 75141 Effective search space used: 75141 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory