Align Gluconate 2-dehydrogenase small subunit (characterized, see rationale)
to candidate HSERO_RS22800 HSERO_RS22800 hypothetical protein
Query= uniprot:A4PIA9 (242 letters) >FitnessBrowser__HerbieS:HSERO_RS22800 Length = 237 Score = 172 bits (436), Expect = 5e-48 Identities = 92/228 (40%), Positives = 144/228 (63%), Gaps = 13/228 (5%) Query: 15 RRAMLQGTALGLVVAA---LFHFPSEGVSEAADREYAYRPVFFSDDEWQTLNSFVDRLIP 71 RRA+L TA + + + L ++G+ E + ++ Y+PVFF+ +W + + DRLIP Sbjct: 9 RRAVLAATAAAVPLVSIPLLKEAQADGL-EGIELQH-YKPVFFNPAQWLFILAACDRLIP 66 Query: 72 ADVEGPGALEAHVPEFIDRQMNTPYGHGSEWYLRPPLMKTS-AALGYQFLFTPRDIYKQG 130 A+ GPGALE +VP FID+Q++ G GS+ Y + P + A LG+Q + P+D+Y+ G Sbjct: 67 AEGRGPGALETNVPVFIDQQLHA--GLGSDIYQQGPHQPDAPATLGFQIPYAPQDVYRIG 124 Query: 131 LPALHSAIMQRYGKPFHQLDAGERDRIIGQMEKGSLTLSPVPSKLL-----FGQILKNCK 185 + Q++GKPF QLDA ++D ++ ++K + + + K + FGQ+L + K Sbjct: 125 ITLTQQISQQQHGKPFEQLDAKDKDALLTALQKNGVDFAALGEKSMRPSQFFGQLLGDTK 184 Query: 186 EGYFADPIHGGNYEMGAWKMIGFPGARADFTDWVDRYGARYPLSPVSV 233 GY ADP++GGN +M AW IGFPGARA +T+WVD++ +YPL PVS+ Sbjct: 185 NGYLADPMYGGNKDMKAWVAIGFPGARAAYTEWVDQHNVKYPLGPVSL 232 Lambda K H 0.321 0.140 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 185 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 237 Length adjustment: 23 Effective length of query: 219 Effective length of database: 214 Effective search space: 46866 Effective search space used: 46866 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory