Align Binding-protein-dependent transport systems inner membrane component (characterized, see rationale)
to candidate HSERO_RS22745 HSERO_RS22745 sugar ABC transporter permease
Query= uniprot:A3DE71 (289 letters) >FitnessBrowser__HerbieS:HSERO_RS22745 Length = 300 Score = 148 bits (374), Expect = 1e-40 Identities = 84/270 (31%), Positives = 144/270 (53%), Gaps = 12/270 (4%) Query: 24 ILAILVVLTLGPIVFMVLTSLMDHNAIARGKWIAPTR----FSNYVEVFQKLPFGIYFRN 79 +L + V+ L PI +++ S+ NAI G PT F+ + +V F +YF N Sbjct: 38 VLCLYAVIALFPIALILINSVKTRNAIFEGPMALPTAETLTFAGFQKVLAGTHFLLYFGN 97 Query: 80 SLIVCSIVMVVALVIATLAGYSLAKYKFPGSGFFGILILATQLLPGMMFLLPLYLDFVKI 139 SL V + + ++ +A ++L +Y+F G+ I + ++P+ L V I Sbjct: 98 SLAVTVAALFLIVLFGAMAAWALTEYRFFGNRALNFFI-------AIGIMIPIRLGTVSI 150 Query: 140 KQ-ATGIQLINSIPGLVIVYSAFFVPFSIWIIRGFFASIPGELEEAARIDGCNKFTAFLR 198 Q + LIN+ LV+VY+A +P ++ I+ F IPGEL++AAR DG + + F R Sbjct: 151 LQLVVALDLINTRTALVLVYTAQGLPLAVMILSEFMRQIPGELKDAARCDGVGELSIFFR 210 Query: 199 VMLPLAVPGIVATAIYIFLTAWDELIFAWVLLKDTKVTTIPAGIRGFIAYTTARYDLLMA 258 V+LPL P I A++ + AW++L F +L T+ G++ FI ++ ++A Sbjct: 211 VILPLLRPAIATVAVFTMIPAWNDLWFPLILAPGEDTRTVTLGVQQFIGQYATDWNSVLA 270 Query: 259 AGTIVTIPVLIMFFTMQKKFISGMTAGAVK 288 A ++ IPVL+++ ++ I G+T+GAVK Sbjct: 271 ALSMAVIPVLLLYMAFSRQLIRGLTSGAVK 300 Lambda K H 0.332 0.145 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 250 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 289 Length of database: 300 Length adjustment: 26 Effective length of query: 263 Effective length of database: 274 Effective search space: 72062 Effective search space used: 72062 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory