Align citrate lyase β subunit (EC 4.1.3.34) (characterized)
to candidate HSERO_RS14045 HSERO_RS14045 aldolase
Query= metacyc::MONOMER-16999 (289 letters) >FitnessBrowser__HerbieS:HSERO_RS14045 Length = 277 Score = 109 bits (273), Expect = 6e-29 Identities = 89/277 (32%), Positives = 140/277 (50%), Gaps = 18/277 (6%) Query: 6 SMLFIPGANAAMLSTSFVYGADAVMFDLEDAVSLREKDTARLLVYQALQHPLYQDIETV- 64 S LF+P + + GADAV+ DLEDAV+ K+ AR + + L P Q + Sbjct: 5 SYLFVPANRPERYAKALDSGADAVIVDLEDAVARPYKEAARETLARWLAGPEGQASQARL 64 Query: 65 -VRINPLNTPFGLADLEAVVRAGVDMVRLPKTDSKEDIHELEAHVERIERECGREVGSTK 123 VRIN +T + DL V + LPK + + + G + Sbjct: 65 WVRINAADTVWHEQDLLTFSALPVAGIVLPKAEDAAGVGAV----------AGALRSGSG 114 Query: 124 LMAAIESALGVVNAVEIARASPRLAAIALAAFDYVMDMGTSRG-DGTELFYARCAVLHAA 182 L+A IESA G+ +IA A+P + +A + D +D+G G + EL R ++ A+ Sbjct: 115 LIALIESAAGLAAMRQIA-AAPGVQRLAFGSIDAQLDLGMQCGPEEEELLSLRVEMVLAS 173 Query: 183 RVAGIAA-YDVVWSDINNEEGFLAEANLAKNLGFNGKSLVNPRQIELLHQVYAPTRKEVD 241 R+AGIAA D V + ++E + A+ LGF K ++PRQ+E++ + + P+ +E+ Sbjct: 174 RLAGIAAPVDGVTAGFDDEALLVRGVERARRLGFGAKLCIHPRQVEVVRRGFLPSEQELA 233 Query: 242 HALEVIAAAEEAETRGLGVVSLNGKMIDGPIIDHARK 278 A EV+AA ++ G +SL G+MID P+I A K Sbjct: 234 WAAEVMAAVRASDG---GAISLKGRMIDRPLILQAEK 267 Lambda K H 0.319 0.134 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 168 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 289 Length of database: 277 Length adjustment: 26 Effective length of query: 263 Effective length of database: 251 Effective search space: 66013 Effective search space used: 66013 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory