Align iron(III) dicitrate transport system permease protein FecD (characterized)
to candidate HSERO_RS21915 HSERO_RS21915 iron-siderophore ABC transporter permease
Query= CharProtDB::CH_004160 (318 letters) >FitnessBrowser__HerbieS:HSERO_RS21915 Length = 364 Score = 145 bits (367), Expect = 1e-39 Identities = 89/278 (32%), Positives = 151/278 (54%), Gaps = 7/278 (2%) Query: 46 VLMEYRLPRLLLALFVGAALAVAGVLIQGIVRNPLASPDILGVNHAASLASVGALLL--- 102 V+ E+RLP ++AL VG L + G +Q ++ NPLASP LG++ AA+ + A+ Sbjct: 82 VVWEFRLPTAVMALLVGMCLGLGGGEMQTVLDNPLASPYTLGISAAAAFGAALAITFNWR 141 Query: 103 MPSLPV-MVLPLLAFAGGMAGLILLKMLAKTH--QPMKLALTGVALSACWASLTDYLMLS 159 P+LP M + A A +A +++L+ +A+ + + L G+AL + +L L Sbjct: 142 FPALPAGMTVSACACAAALASVLVLERVARWRGGSTLGVILFGIALVYSFQALIMLLQFV 201 Query: 160 RPQD-VNNALLWLTGSLWGRDWSFVKIAIPLMILFLPLSLSFCRDLDLLALGDARATTLG 218 ++ + + W GSL W+ V I L P SL L L LG+ RA + G Sbjct: 202 ASEEALQGIVFWTMGSLARASWTTVAILGLAFALVAPFSLRDAWKLTALRLGEERAASFG 261 Query: 219 VSVPHTRFWALLLAVAMTSTGVAACGPISFIGLVVPHMMRSITGGRHRRLLPVSALTGAL 278 + +P R +LL + + V+ G I F+GLV PH+ R + G HR LP SA+ G L Sbjct: 262 IDMPRLRMLSLLRISVLAALSVSFVGTIGFVGLVAPHIARLLLGEDHRYYLPGSAMAGGL 321 Query: 279 LLVVADLLARIIHPPLELPVGVLTAIIGAPWFVWLLVR 316 ++ +A + ++ + P + +PVG++T+++G P F+ +++R Sbjct: 322 IISLASVASKTLLPGVLIPVGIVTSLVGIPLFLIIVLR 359 Lambda K H 0.330 0.142 0.447 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 268 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 364 Length adjustment: 28 Effective length of query: 290 Effective length of database: 336 Effective search space: 97440 Effective search space used: 97440 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory