Align iron(III) dicitrate transport ATP-binding protein FecE (characterized)
to candidate HSERO_RS21910 HSERO_RS21910 iron ABC transporter ATP-binding protein
Query= CharProtDB::CH_088321 (255 letters) >FitnessBrowser__HerbieS:HSERO_RS21910 Length = 263 Score = 139 bits (351), Expect = 5e-38 Identities = 89/242 (36%), Positives = 125/242 (51%), Gaps = 4/242 (1%) Query: 2 TLRTENLTVSYGTDKVLNDVSL-SLPTGKITALIGPNGCGKSTLLNCFSRLLMPQSGTVF 60 +L L V+YG V+ + L L G +TAL+GPNG GKSTLL L Q+G+V Sbjct: 5 SLCVAGLKVAYGRHSVIQGLDLPELTAGSVTALLGPNGSGKSTLLRTLGGLTRAQAGSVR 64 Query: 61 LGDNPINMLSSRQLARRLSLLPQHHLTPEGITVQELVSYGRNPWLSLWGRLSAEDNARVN 120 LG + + A+ + +PQ P ++V E V R ++ RV Sbjct: 65 LGPTELAQADAAARAQHVVYMPQSLPRPVHLSVFESVLVAAQALQRT--RPDTQELERVQ 122 Query: 121 VAMNQTRINHLAVRRLTELSGGQRQRAFLAMVLAQNTPVVLLDEPTTYLDINHQVDLMRL 180 + I HLA R L ELSGGQRQ A LA L + V+LLDEP + LD+N+Q +M L Sbjct: 123 ALLQHLGIGHLAQRHLDELSGGQRQLAALAQALVRRPRVLLLDEPLSALDLNYQYLVMDL 182 Query: 181 M-GELRTQGKTVVAVLHDLNQASRYCDQLVVMANGHVMAQGTPEEVMTPGLLRTVFSVEA 239 + E R G + VLHDLN A R+ D+ +++ G ++ G EV+TP L + V+ Sbjct: 183 LRQETRLHGLVTLVVLHDLNTAFRHVDRALLLHQGRLLCAGAAREVITPATLAQAYGVDG 242 Query: 240 EI 241 I Sbjct: 243 RI 244 Lambda K H 0.320 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 185 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 263 Length adjustment: 24 Effective length of query: 231 Effective length of database: 239 Effective search space: 55209 Effective search space used: 55209 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory