Align ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized)
to candidate HSERO_RS21250 HSERO_RS21250 amino acid ABC transporter ATP-binding protein
Query= reanno::pseudo3_N2E3:AO353_03040 (254 letters) >FitnessBrowser__HerbieS:HSERO_RS21250 Length = 244 Score = 243 bits (619), Expect = 3e-69 Identities = 127/246 (51%), Positives = 172/246 (69%), Gaps = 11/246 (4%) Query: 4 LEVQDLHKRYGSHEVLKGVSLKAAAGDVISIIGSSGSGKSTFLRCINLLEQPHAGKILLN 63 + + ++ KR+G +EVLKG+SL G+VI+IIG SGSGKST LRCIN LE G I + Sbjct: 4 IAIDNVKKRFGDNEVLKGISLDVEPGEVIAIIGKSGSGKSTLLRCINGLESIDEGNISVA 63 Query: 64 NEELKLVANKDGALKAADPKQLQRMRSRLSMVFQHFNLWSHMTAMENIMEAPVHVLGMSK 123 GA A +L+ +R ++ M+FQ FNL+ H++ N+M AP+ V G+S+ Sbjct: 64 -----------GAKLGASELELRNLRLKVGMIFQQFNLFPHLSVGRNVMIAPMIVKGVSE 112 Query: 124 AEAREKAELYLAKVGVSHRKDAYPGHMSGGEQQRVAIARALAMEPEVMLFDEPTSALDPE 183 AEA + A+ L KVG+ H+ DAYP +SGG+QQRVAIARAL+M P+ +L DE TSALDPE Sbjct: 113 AEAMKTAKANLEKVGLGHKFDAYPDQLSGGQQQRVAIARALSMSPQALLCDEITSALDPE 172 Query: 184 LVGDVLKVMQALAQEGRTMVVVTHEMGFAREVSNQLVFLHKGVVEESGNPREVLVNPQSE 243 LV +VL VM+ LA+EG T+++VTHEM FAREV N+LVF+H+G V E G P E+ NP++ Sbjct: 173 LVNEVLTVMRGLAKEGMTLLMVTHEMRFAREVCNRLVFMHQGKVHEIGPPEELFGNPKTP 232 Query: 244 RLQQFL 249 LQQF+ Sbjct: 233 ELQQFI 238 Lambda K H 0.317 0.131 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 188 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 244 Length adjustment: 24 Effective length of query: 230 Effective length of database: 220 Effective search space: 50600 Effective search space used: 50600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory