Align ABC transporter for L-Arginine and L-Citrulline, periplasmic substrate-binding component (characterized)
to candidate HSERO_RS10775 HSERO_RS10775 cysteine ABC transporter substrate-binding protein
Query= reanno::pseudo3_N2E3:AO353_03055 (258 letters) >FitnessBrowser__HerbieS:HSERO_RS10775 Length = 267 Score = 119 bits (299), Expect = 5e-32 Identities = 76/254 (29%), Positives = 134/254 (52%), Gaps = 13/254 (5%) Query: 5 VLLGALALSVLSL-PTFADEKPLKIGIEAAYPPFASKAPD-GSIVGFDYDIGNALCEEMK 62 +L +L++S L + LK+ +E YPPF K P G + GF+ D+ L ++ Sbjct: 17 LLASSLSVSAADLLQSVKSSGTLKVALEGNYPPFNFKDPKTGELTGFEVDVAKLLAAKLG 76 Query: 63 VKCVWVEQEFDGLIPALKVRKIDAILSSMSITDDRKKSVDFTNKYYNTPARLVM-KAGTQ 121 VK V+ E+ G++ L K D I++ + ITD+R+K+ DF++ Y + A+L++ K + Sbjct: 77 VKPVFTTTEWSGILAGLGAGKYDVIINQVGITDERQKAFDFSDPYTLSSAQLIVRKDEKR 136 Query: 122 VSDNLAELKGKKIGVQRGSIHNRFAEEVLKPLGAEIKPYGSQNEIYLDVAAGRLDGTVAD 181 +L +LKGKK+G+ +G+ F ++ G +++ Y E D+AAGR+D + D Sbjct: 137 EFKSLEDLKGKKLGLGQGT---NFEQKAKAVPGIDVRTYPGSPEYLADLAAGRIDAALND 193 Query: 182 ATLLDDGFLKTDSGKGFAFVGPAFTDEKYFGDGIGIAVRKGDKAELDKINAAIVAIRANG 241 + L+ G++ + P +K IGI RKG+ +N A+ I+A+G Sbjct: 194 SLLV--GYILKSTNLPLKAGSPIGAVDK-----IGIPFRKGNPEFKAALNKALADIKADG 246 Query: 242 KYKQIQDKYFNFDI 255 +K +K+F D+ Sbjct: 247 SFKAASEKWFGIDV 260 Lambda K H 0.318 0.138 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 179 Number of extensions: 12 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 267 Length adjustment: 25 Effective length of query: 233 Effective length of database: 242 Effective search space: 56386 Effective search space used: 56386 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory