Align ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale)
to candidate HSERO_RS01190 HSERO_RS01190 amino acid ABC transporter ATP-binding protein
Query= uniprot:A0A1N7U8S3 (276 letters) >FitnessBrowser__HerbieS:HSERO_RS01190 Length = 242 Score = 239 bits (609), Expect = 5e-68 Identities = 127/249 (51%), Positives = 177/249 (71%), Gaps = 11/249 (4%) Query: 27 LQVEGIHKRYGEHEVLKGVSLNARQGDVISLIGASGSGKSTMLRCINFLEQPDAGVITLD 86 ++++G+HKR+G + VL+GVS +G+V+++IG SGSGKST LRCIN LEQ DAG I++ Sbjct: 5 VELQGVHKRFGSNTVLRGVSFQVARGEVVAIIGKSGSGKSTALRCINRLEQIDAGQISVC 64 Query: 87 GISIEMRQGRAGTRAPHQDQLQNLRTRLAMVFQHFNLWSHMTVLENITMAPRRVLDVSAA 146 G ++ AG L+ LR + +VFQ +NL+ H+TVL+NIT+ P V + A Sbjct: 65 GHALHA----AGL------DLRGLRRDVGIVFQGYNLFPHLTVLQNITLGPTAVKRMPAD 114 Query: 147 EAEKRARMYLDKVGLPSRVADQYPAFLSGGQQQRVAIARALAMEPEIILFDEPTSALDPE 206 +A+ A+ L +VGL + A YP LSGGQQQRVAIAR+LA++P+++LFDE TSALDPE Sbjct: 115 QAQTLAQQVLARVGLADK-AGAYPEQLSGGQQQRVAIARSLALQPQLMLFDEVTSALDPE 173 Query: 207 LVGEVLKVIQTLAEEGRTMLMVTHEMGFARQVSSQVLFLHQGRVEEHGDARILDQPNSER 266 L GEVLKV++ +A EG TM++VTHEM FAR+V+ QV+F+HQG+V E G ILD P + Sbjct: 174 LTGEVLKVMEQMASEGMTMILVTHEMAFARRVADQVIFMHQGQVWEQGGPEILDAPVTPE 233 Query: 267 LQQFLSNRL 275 L+ F+ L Sbjct: 234 LRSFVGTGL 242 Lambda K H 0.319 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 218 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 242 Length adjustment: 24 Effective length of query: 252 Effective length of database: 218 Effective search space: 54936 Effective search space used: 54936 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory