GapMind for catabolism of small carbon sources

 

Aligments for a candidate for davT in Herbaspirillum seropedicae SmR1

Align 4-aminobutyrate aminotransferase PuuE; GABA aminotransferase; GABA-AT; Gamma-amino-N-butyrate transaminase; GABA transaminase; Glutamate:succinic semialdehyde transaminase; EC 2.6.1.19 (characterized)
to candidate HSERO_RS16670 HSERO_RS16670 acetylornithine aminotransferase

Query= SwissProt::P50457
         (421 letters)



>lcl|FitnessBrowser__HerbieS:HSERO_RS16670 HSERO_RS16670
           acetylornithine aminotransferase
          Length = 400

 Score =  149 bits (377), Expect = 1e-40
 Identities = 120/397 (30%), Positives = 187/397 (47%), Gaps = 40/397 (10%)

Query: 34  LKDVEGNEYIDFAAGIAVLNTGHRHPDLVAAVEQQLQQFTHTAYQIVPYESYVTLAEKIN 93
           L D  G  Y+D+  G AV   GH    +  A+  Q ++  + +      E  + LA+ + 
Sbjct: 30  LTDHNGKRYLDYLQGWAVNTLGHAPQCIADALAAQSKKLINPSPAFYN-EPSIELAKLLT 88

Query: 94  ALAPVSGQAKTAFFTTGAEAVENAVKIARAH---------TGRPGVIAFSGGFHGRTYMT 144
           A +      +  F  +G EA E A+K+AR           + R  +I F   FHGRT  T
Sbjct: 89  ANSVFD---RVFFANSGGEANEGAIKLARKWGKKNPAADGSARFEIITFKHSFHGRTLAT 145

Query: 145 MALTGKVAPYKIGFGP-FPGSVYHVPYPSDLHGISTQDSLDAIERLFKSDIEAKQVAAII 203
           M+ +GK   +   F P  PG      +P      +  + L++++ L       +   A++
Sbjct: 146 MSASGKDG-WDTMFAPQVPG------FPK-----AVLNDLESVKALI-----GEHTVAVM 188

Query: 204 FEPVQGEGGFNVAPKELVAAIRRLCDEHGIVMIADEVQSGFARTGKLFAMDHYADKPDLM 263
            EPVQGEGG   A KE +  +R L  E  +++I DEVQSG  RTG+LFA  H   +PD+M
Sbjct: 189 LEPVQGEGGVIPASKEFMQGLRSLTKEKNLLLIVDEVQSGMGRTGQLFAYQHSGIEPDIM 248

Query: 264 TMAKSLAGGMPLSGVVGNANIMDAPAPGGLGGTYAGNPLAVAAAHAVLNIIDKESLCERA 323
           T+AK + GG+PL+ ++    I    A G  GGTY GNPL  A   AV+  + K    E  
Sbjct: 249 TLAKGIGGGVPLAALLAREEIACFEA-GEQGGTYNGNPLMTAVGVAVIKELLKPGFMESV 307

Query: 324 NQLGQRLKNTLIDAKESVPAIAAVRGLGSMIAVEFNDPQTGEPSAAIAQKIQQRALAQGL 383
            + GQ L+   ++  E        RG G + A++      G      A+ ++      GL
Sbjct: 308 RERGQYLRQRSLEISEKY-GFEGERGEGLLRALQLG-RDIGPQIVEAARNLE----PVGL 361

Query: 384 LLLTCGAYGNVIRFLYPLTIPDAQFDAAMKILQDALS 420
           LL +     N++RF+  L +   + D    +L++ L+
Sbjct: 362 LLNS--PRPNLLRFMPALNVTKEEIDQMFSMLEEVLA 396


Lambda     K      H
   0.319    0.134    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 373
Number of extensions: 13
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 421
Length of database: 400
Length adjustment: 31
Effective length of query: 390
Effective length of database: 369
Effective search space:   143910
Effective search space used:   143910
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory