GapMind for catabolism of small carbon sources

 

Aligments for a candidate for patA in Herbaspirillum seropedicae SmR1

Align putrescine-2-oxoglutarate transaminase (EC 2.6.1.82) (characterized)
to candidate HSERO_RS17580 HSERO_RS17580 hypothetical protein

Query= BRENDA::P42588
         (459 letters)



>lcl|FitnessBrowser__HerbieS:HSERO_RS17580 HSERO_RS17580
           hypothetical protein
          Length = 440

 Score =  191 bits (485), Expect = 4e-53
 Identities = 131/421 (31%), Positives = 208/421 (49%), Gaps = 40/421 (9%)

Query: 70  AGSLNTLVDTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPL-HSQELLDPLRAM 128
           AG    L+D  G+ +ID  GG  +  +GH +P V+ A++ Q+ +    H+          
Sbjct: 18  AGEGMELIDQDGKRYIDASGGAAVSCLGHGHPRVIEAIRKQVGELAYAHTSFFTTAPAEE 77

Query: 129 LAKTLAALTPGKLKYSFFCNSGTESVEAALKLAKAYQSPRG---KFTFIATSGAFHGKSL 185
           LA  LA   PG L + +F + G+E+VEAALKLA+ Y    G   +   IA   ++HG +L
Sbjct: 78  LAAMLADAAPGSLNHVYFLSGGSEAVEAALKLARQYYVEVGQPQRRHIIARRQSYHGNTL 137

Query: 186 GALSATAKSTFRKPFMPLLPGFRHVP-----------FGNIEAMRTALNECKKT-----G 229
           GAL+    +  R+ FMP+L    HV              +++ ++   +E ++       
Sbjct: 138 GALAIGGNAWRREMFMPMLIEAHHVSPCYAYRNRADGESDVQYVQRLADELEQKILSLGA 197

Query: 230 DDVAAVILEPIQGEGGVILPPPG-YLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEH 288
           D V A + E + G     +PP G Y   +R +CD++G L+ILDEV +GMGRTG +FACE 
Sbjct: 198 DQVIAFVAETVVGATAGAVPPVGDYFRKIRAVCDKYGVLLILDEVMSGMGRTGYLFACEE 257

Query: 289 ENVQPDILCLAKALGGGVMPIGATIATEEVFSVLFDNP--FLHTTTFGGNPLACAAALAT 346
           + V PDI+ +AK LG G  PIGA I ++ ++  +      F H  T+ G+  ACAAA+A 
Sbjct: 258 DGVVPDIVVIAKGLGAGYQPIGAMICSDHIYDAVLRGSGFFQHGHTYIGHATACAAAVAV 317

Query: 347 INVLLEQNLPAQAEQKGDMLLDGFRQLAREYPDLVQEARGKGMLMAIEFV---------- 396
              + E+ L     Q+G+ L    RQ   +    V + RG+G+ + +E V          
Sbjct: 318 QKTIQEERLLENVRQRGEQLRSELRQAFGDQAH-VGDIRGRGLFVGVELVAERSSKLPLS 376

Query: 397 -DNEIGYNFASEMFRQRVLV---AGTLN--NAKTIRIEPPLTLTIEQCELVIKAARKALA 450
            D        +E  ++ +LV    GT++  N   I + PP   +      +++    A+A
Sbjct: 377 PDLRTHARVKAEAMKRGLLVYPMGGTIDGKNGDHILLAPPFIASSNDISEIVQRLSDAVA 436

Query: 451 A 451
           A
Sbjct: 437 A 437


Lambda     K      H
   0.320    0.135    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 503
Number of extensions: 30
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 459
Length of database: 440
Length adjustment: 33
Effective length of query: 426
Effective length of database: 407
Effective search space:   173382
Effective search space used:   173382
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory