Align Gamma-glutamyl-GABA hydrolase (EC 3.5.1.94) (characterized)
to candidate HSERO_RS21960 HSERO_RS21960 glutamine amidotransferase
Query= reanno::pseudo6_N2E2:Pf6N2E2_4510 (258 letters) >FitnessBrowser__HerbieS:HSERO_RS21960 Length = 378 Score = 108 bits (271), Expect = 1e-28 Identities = 72/183 (39%), Positives = 99/183 (54%), Gaps = 12/183 (6%) Query: 54 DILDALDGILLTGSPSNVEPFHYQGPASAPGTAHDPARDATTLPLIRAAVDAGIPVLGIC 113 D LDG++L G ++V P Y A+ P + D RD L L+ ++AG PVLGIC Sbjct: 187 DYAKHLDGLVLQGG-ADVSPQSYAQSATRPEWSGDRVRDMYELELLHEFIEAGKPVLGIC 245 Query: 114 RGFQEMNVAFGGSLHQKV-HEVGTFIDHREDDTQAVDVQY-GPAHAVHIQPGGVLAGLGL 171 RG Q +NVAFGG+L+Q + +V T I H V+ QY H +H G LA L Sbjct: 246 RGCQLINVAFGGTLYQDIATDVPTAIPH-------VNEQYDSNYHTLHFPQGSSLANLLK 298 Query: 172 PQRIEVNSIHSQGIERLAPGLRAEAVA-PDGLIEAVSVPGGKAFALGVQWHPEWEVSSNP 230 + VNSIH Q + L L EAV+ PD ++EA+ F +G+QWHPE+ + +P Sbjct: 299 AENAVVNSIHHQAVRDLGRDLSVEAVSGPDQIVEAIRYRKA-PFVMGLQWHPEFHRAGSP 357 Query: 231 HYL 233 L Sbjct: 358 ELL 360 Lambda K H 0.319 0.136 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 291 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 378 Length adjustment: 27 Effective length of query: 231 Effective length of database: 351 Effective search space: 81081 Effective search space used: 81081 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory