Align deoxynucleoside transporter, permease component 2 (characterized)
to candidate HSERO_RS05325 HSERO_RS05325 ribose ABC transporter permease
Query= reanno::Burk376:H281DRAFT_01112 (364 letters) >FitnessBrowser__HerbieS:HSERO_RS05325 Length = 328 Score = 155 bits (393), Expect = 1e-42 Identities = 105/309 (33%), Positives = 156/309 (50%), Gaps = 12/309 (3%) Query: 46 LARNPEWFTVALIVVTCLIVGAINPRFFQFATLFDLLHSATTMSLFALGTLVVLASGGID 105 L +P +A +VV L++G + FF + F++L + + + A+G V+ +GGID Sbjct: 24 LIHSPLALPLAGLVVVSLLMGLASDNFFTLSNWFNVLRQVSIVGILAVGMSFVILTGGID 83 Query: 106 VSFTAIAALTMYGITKAVFAWWPDAPFALILVTGALGGVVLGMVNGLLVHRLKAPSLIVT 165 +S A AL G A P L L+ G +G++NG LV + P++IVT Sbjct: 84 LSVGAAMALA--GTISAGLIVNSGLPAPLALLCGVGLATCIGLLNGALVAWGRMPAIIVT 141 Query: 166 IGTQYLYRGLLLTFIGTTFFMNIPHSMDRFGRIPLFFYHTADGLRAVLPVSVLALVAAAV 225 + T + RG+ L + G +P + FG G ++PV V+ ++ Sbjct: 142 LATMGVARGVGLIYSGGYPISGLPGWISWFGV----------GRIGMVPVPVILMLIVYA 191 Query: 226 VTWWLLNRTMMGRAVYAMGGSLAIAERLGYNLRAIHLFVFGYTGMLAGIAGILHVSNNRL 285 + W LL RT GR VYA+GG+ A G I L V+ +G +G+A I+ Sbjct: 192 LAWLLLQRTAFGRHVYAIGGNEMAARLSGVKTTRIKLAVYAISGFTSGLAAIILTGRLMS 251 Query: 286 ANPFDLVGSELDVIAAVILGGARITGGTGTVVGTLLGVVLVTLIKSVLILVGVPSTWQKV 345 P VG ELD IAAV+LGG I GG G VVGTL+G VL+ ++ + L L+G+ Q + Sbjct: 252 GQPNAGVGFELDAIAAVVLGGTAIAGGRGLVVGTLIGAVLLGILNNGLNLMGINPYLQDI 311 Query: 346 IIGAFILLA 354 I G ILLA Sbjct: 312 IRGVIILLA 320 Lambda K H 0.328 0.141 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 316 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 364 Length of database: 328 Length adjustment: 29 Effective length of query: 335 Effective length of database: 299 Effective search space: 100165 Effective search space used: 100165 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory