Align 2-deoxy-D-ribonate dehydrogenase (characterized)
to candidate HSERO_RS11255 HSERO_RS11255 3-ketoacyl-ACP reductase
Query= metacyc::MONOMER-20835 (262 letters) >FitnessBrowser__HerbieS:HSERO_RS11255 Length = 252 Score = 119 bits (297), Expect = 8e-32 Identities = 86/250 (34%), Positives = 131/250 (52%), Gaps = 18/250 (7%) Query: 16 LISGGAAGIGEVLAAAYLEAGAQVHVCDVSESA-LAVFRD-KYPG--TVATRADVSDAAQ 71 +++GG +G GE +A AY GA + V D+ E+ L V + K G V +ADVS A Sbjct: 9 IVTGGGSGFGEGIAKAYAREGAAIVVADIGEAGGLRVVEEIKAAGGRAVFAKADVSKRAD 68 Query: 72 IEAVFKVQREHLGGLDVLVNNAGIAGPTGGIDAISDAEWQATININLTAQYRFAHHAVPM 131 ++ + EH G LD++VNNAG + + + E+ +N+ + + A VP Sbjct: 69 MDQLLATALEHFGKLDIVVNNAGTTHRNRPMLEVEEDEFDRVYAVNVKSIFLSAKTFVPY 128 Query: 132 LKESSHGHLLHIASVAG---RLGYAWRTPYAATKWAIVGLMKSLASELGESDIRVNALLP 188 ++ G ++IAS AG R G W Y +K A++ KS+A+ELG IRVN + P Sbjct: 129 FRQVGGGAFINIASTAGIRPRPGLTW---YNGSKGAVITTSKSMAAELGPDKIRVNCVNP 185 Query: 189 GIVEGPRMDGVIRARAEQVGVPEA-EMRQEYLNKISLKRMVTAEDVAAMALFLCSPAARN 247 I G++ +E +GVP+ E R++++ I + R T ED+A L+L S A Sbjct: 186 VI----SATGLL---SEFMGVPDTPENRKKFVATIPMGRFSTPEDIANACLYLGSDEAEF 238 Query: 248 VTGQAISVDG 257 VTG I VDG Sbjct: 239 VTGVCIEVDG 248 Lambda K H 0.318 0.133 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 145 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 252 Length adjustment: 24 Effective length of query: 238 Effective length of database: 228 Effective search space: 54264 Effective search space used: 54264 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory