Align deoxyribose-phosphate aldolase (EC 4.1.2.4) (characterized)
to candidate HSERO_RS05120 HSERO_RS05120 deoxyribose-phosphate aldolase
Query= BRENDA::Q9Y315 (318 letters) >FitnessBrowser__HerbieS:HSERO_RS05120 Length = 343 Score = 357 bits (915), Expect = e-103 Identities = 183/303 (60%), Positives = 231/303 (76%), Gaps = 2/303 (0%) Query: 11 DLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQR 70 D + +++N A +R ++ RR+VKK+ QAAWLLKA+T IDLTTLSGDDT ++R Sbjct: 38 DAAAFEHLRINLSAAEKRVATLKGRRSVKKDAQAAWLLKAITCIDLTTLSGDDTPQRVRR 97 Query: 71 LCYKAKYPIREDLLKALNMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVASVAAGFP 130 LC KA P+R DLL+AL M D+G+TT AVCVY V AV AL+ G IPVA+V+ GFP Sbjct: 98 LCAKAANPLRADLLEALGMQDRGLTTGAVCVYHRFVKTAVDALEGKG--IPVAAVSTGFP 155 Query: 131 AGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEALYDEIRQFRKACGEAHLKTI 190 AG +L+EI +V DGA EID+VI R VLTG WEALY E+R FR+ACGEAH+K I Sbjct: 156 AGLNPHALKLKEIEASVRDGAAEIDIVITREHVLTGNWEALYREMRDFRQACGEAHVKAI 215 Query: 191 LATGELGTLTNVYKASMIAMMAGSDFIKTSTGKETVNATFPVAIVMLRAIRDFFWKTGNK 250 LATGEL TL NV KASM+ MMAG+DFIKTSTGKE+VNAT V++VMLR IR + TG K Sbjct: 216 LATGELKTLRNVAKASMVCMMAGADFIKTSTGKESVNATPLVSLVMLRMIRQYQEMTGIK 275 Query: 251 IGFKPAGGIRSAKDSLAWLSLVKEELGDEWLKPELFRIGASTLLSDIERQIYHHVTGRYA 310 +G+KPAGG+ +AKD L + L+KEELG +WL+P+LFR+GAS+LL+DIERQ+ HHVTGRY+ Sbjct: 276 VGYKPAGGVATAKDVLEYQVLMKEELGHDWLQPDLFRVGASSLLADIERQLEHHVTGRYS 335 Query: 311 AYH 313 A++ Sbjct: 336 AFN 338 Lambda K H 0.320 0.133 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 342 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 343 Length adjustment: 28 Effective length of query: 290 Effective length of database: 315 Effective search space: 91350 Effective search space used: 91350 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate HSERO_RS05120 HSERO_RS05120 (deoxyribose-phosphate aldolase)
to HMM TIGR00126 (deoC: deoxyribose-phosphate aldolase (EC 4.1.2.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00126.hmm # target sequence database: /tmp/gapView.13202.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00126 [M=211] Accession: TIGR00126 Description: deoC: deoxyribose-phosphate aldolase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-48 150.2 0.6 1.5e-47 147.8 0.6 1.9 1 lcl|FitnessBrowser__HerbieS:HSERO_RS05120 HSERO_RS05120 deoxyribose-phosph Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__HerbieS:HSERO_RS05120 HSERO_RS05120 deoxyribose-phosphate aldolase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 147.8 0.6 1.5e-47 1.5e-47 4 205 .. 79 305 .. 76 307 .. 0.93 Alignments for each domain: == domain 1 score: 147.8 bits; conditional E-value: 1.5e-47 TIGR00126 4 kliDhtalkadtteedietlcaeAkky................kfaavcvnpsyvslAkelLkgteve 55 + iD+t+l+ d+t++ + +lca+A ++ + avcv+ ++v+ A++ L+g+ + lcl|FitnessBrowser__HerbieS:HSERO_RS05120 79 TCIDLTTLSGDDTPQRVRRLCAKAANPlradllealgmqdrglTTGAVCVYHRFVKTAVDALEGKGIP 146 68**********************9988888888787777776788********************** PP TIGR00126 56 ictv.vgFPlGasttevkllEakeaieeGAdEvDvviniaalkdkneevviedikavveacakvllKv 122 +++v +gFP+G + + kl E +++++ GA E+D+vi + +n+e+ +++++ +ac+++++K+ lcl|FitnessBrowser__HerbieS:HSERO_RS05120 147 VAAVsTGFPAGLNPHALKLKEIEASVRDGAAEIDIVITREHVLTGNWEALYREMRDFRQACGEAHVKA 214 ***978************************************************************** PP TIGR00126 123 ilEtalLtdeekk.kAseisieagadfvKtstgfsakgAtvedvrlmkkvvgd.......evgvKasG 182 il t++L+ + kAs +++ agadf+Ktstg+ ++At+ +m +++++ +vg K++G lcl|FitnessBrowser__HerbieS:HSERO_RS05120 215 ILATGELKTLRNVaKASMVCMMAGADFIKTSTGKESVNATPLVSLVMLRMIRQyqemtgiKVGYKPAG 282 *******9876655**************************99988999999888999999******** PP TIGR00126 183 Gvrtaedalalieagaerigasa 205 Gv ta+d+l++ e +g ++ lcl|FitnessBrowser__HerbieS:HSERO_RS05120 283 GVATAKDVLEYQVLMKEELGHDW 305 *********99888888887765 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (211 nodes) Target sequences: 1 (343 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 3.86 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory