Align deoxyribose kinase (EC 2.7.1.15) (characterized)
to candidate HSERO_RS05105 HSERO_RS05105 ribokinase
Query= reanno::Burk376:H281DRAFT_01116 (320 letters) >FitnessBrowser__HerbieS:HSERO_RS05105 Length = 319 Score = 340 bits (873), Expect = 2e-98 Identities = 183/314 (58%), Positives = 216/314 (68%), Gaps = 1/314 (0%) Query: 1 MSSQPQQSGRVVILGIYVTDLTFRAARMPLVGETIAGSAFAMGPGGKGSNQAVAAARAGA 60 M+S P + G V +LGIYV DL FRA MP +G+TIAG+ FAMGPGGKGSNQAVAAAR GA Sbjct: 1 MTSFPHKQG-VAVLGIYVADLAFRAPNMPGLGQTIAGTGFAMGPGGKGSNQAVAAARVGA 59 Query: 61 EVVFCTRIGNDAFGSIAQATWAREGITARASVVEGVSTGAAHIFVDDTTGMNAIIVAAGA 120 V F + IG DAFG A + W RE I V++G TGAA I+V+D +G NAIIV GA Sbjct: 60 PVRFISAIGKDAFGDFALSLWRRETIAPHVRVIDGAPTGAAFIYVNDASGDNAIIVVPGA 119 Query: 121 AGTLSAADVDAIEADIAGSRVFVTQLEQPLAAARRGLEVARKHGVTTVFNPAPALPLDDD 180 A LS DV+ I ++VFVTQLEQP AA GL++AR G TTVFNPAPAL Sbjct: 120 ASQLSEQDVERERQAIEAAKVFVTQLEQPPEAALAGLQIARAAGTTTVFNPAPALAFPAQ 179 Query: 181 IFPLCDYITPNETEAAALTGVPIANVDDARRAADVLLAKGVGTVIVTLGEGGALLHDATQ 240 ++ LCD+ITPNE EAA LTG+ I ++DDARRAADVLL +GVG ++TLG G+LLH +Q Sbjct: 180 VYGLCDFITPNEHEAALLTGIEIHHIDDARRAADVLLERGVGCALITLGAQGSLLHSRSQ 239 Query: 241 SIWLPAFRCGAVVETAGAGDGFTGGFAAALARGEDAISAMRFGCALAGISVTRAGTAPSM 300 S+ LPA G VVETAGAGD F G FAA LA G A A R A+A ISVTR GTAPSM Sbjct: 240 SLHLPALCAGTVVETAGAGDAFNGAFAAGLAEGMSAEEAARLATAVAAISVTRPGTAPSM 299 Query: 301 PTLAEVNRVLSESA 314 P+ E +L A Sbjct: 300 PSRQEALALLDTHA 313 Lambda K H 0.318 0.132 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 273 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 320 Length of database: 319 Length adjustment: 28 Effective length of query: 292 Effective length of database: 291 Effective search space: 84972 Effective search space used: 84972 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate HSERO_RS05105 HSERO_RS05105 (ribokinase)
to HMM TIGR02152 (rbsK: ribokinase (EC 2.7.1.15))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR02152.hmm # target sequence database: /tmp/gapView.9821.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02152 [M=298] Accession: TIGR02152 Description: D_ribokin_bact: ribokinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.6e-97 310.2 0.7 8.6e-97 310.0 0.7 1.0 1 lcl|FitnessBrowser__HerbieS:HSERO_RS05105 HSERO_RS05105 ribokinase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__HerbieS:HSERO_RS05105 HSERO_RS05105 ribokinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 310.0 0.7 8.6e-97 8.6e-97 1 295 [. 10 304 .. 10 307 .. 0.97 Alignments for each domain: == domain 1 score: 310.0 bits; conditional E-value: 8.6e-97 TIGR02152 1 ivvvGSinvDlvlrvkrlpkpGetvkaeefkiaaGGKGANQAvaaarlgaevsmigkvGkDefgeell 68 ++v+G + +Dl +r++++p G+t++++ f +++GGKG+NQAvaaar+ga v++i+++GkD+fg+ +l lcl|FitnessBrowser__HerbieS:HSERO_RS05105 10 VAVLGIYVADLAFRAPNMPGLGQTIAGTGFAMGPGGKGSNQAVAAARVGAPVRFISAIGKDAFGDFAL 77 78****************************************************************** PP TIGR02152 69 enlkkegidteyvkkvkktstGvAlilvde.egeNsIvvvaGaneeltpedvkaaeekikesdlvllQ 135 + +++e i + +v+ ++ ++tG A+i v++ +g+N+I+vv Ga ++l+++dv++++++i+++++ + Q lcl|FitnessBrowser__HerbieS:HSERO_RS05105 78 SLWRRETI-APHVRVIDGAPTGAAFIYVNDaSGDNAIIVVPGAASQLSEQDVERERQAIEAAKVFVTQ 144 ********.789****************97368*********************************** PP TIGR02152 136 lEipletveealkiakkagvkvllnPAPaekkldeellslvdiivpNetEaeiLtgievedledaeka 203 lE p e++ + l+ia++ag+++++nPAPa + +++++ l+d+i+pNe+Ea++Ltgie+++++da++a lcl|FitnessBrowser__HerbieS:HSERO_RS05105 145 LEQPPEAALAGLQIARAAGTTTVFNPAPAL-AFPAQVYGLCDFITPNEHEAALLTGIEIHHIDDARRA 211 *****************************5.599********************************** PP TIGR02152 204 aekllekgvkaviitlGskGallvskdekklipalkv.kavDttaAGDtFigalavaLaegksledav 270 a+ lle+gv +itlG++G+ll+s++++ ++pal + ++v t++AGD+F+ga+a+ Laeg+s+e+a lcl|FitnessBrowser__HerbieS:HSERO_RS05105 212 ADVLLERGVGCALITLGAQGSLLHSRSQSLHLPALCAgTVVETAGAGDAFNGAFAAGLAEGMSAEEAA 279 **********************************98736789************************** PP TIGR02152 271 rfanaaaalsVtrkGaqssiPtkee 295 r a+a+aa+sVtr G+++s+P+++e lcl|FitnessBrowser__HerbieS:HSERO_RS05105 280 RLATAVAAISVTRPGTAPSMPSRQE 304 ***********************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (298 nodes) Target sequences: 1 (319 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 10.16 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory