Align 2-deoxy-D-ribonate transporter 1 (characterized)
to candidate HSERO_RS05735 HSERO_RS05735 MFS transporter
Query= reanno::WCS417:GFF1429 (438 letters) >FitnessBrowser__HerbieS:HSERO_RS05735 Length = 442 Score = 318 bits (815), Expect = 2e-91 Identities = 165/407 (40%), Positives = 232/407 (57%), Gaps = 4/407 (0%) Query: 20 KLMPLLIIAYILSFLDRTNIALAKHHLDVDLGISAAAYGLGAGLFFLTYALSEIPSNLIM 79 +++PL +I +I++++DR NI + HL D+GI AAYGLGAGLFF+ YAL E+PSNL++ Sbjct: 29 RVLPLFVIMFIVNYIDRVNIGFVRSHLATDVGIGTAAYGLGAGLFFVGYALFEVPSNLLL 88 Query: 80 HKVGARFWIARIMVTWGLISAAMAFVQGETSFYVLRLLLGIAEAGLFPGVMLYLTYWFNR 139 + GA+ W+ RIM TWGL + AMAFV ET+FYVLR LLG AEAG FPGV+ Y T W Sbjct: 89 QRFGAKAWLTRIMATWGLAATAMAFVNSETTFYVLRFLLGAAEAGFFPGVIYYFTQWLPA 148 Query: 140 EQRARATGYFLLGVCFANIIGGPVGAALMRMDGMLGWHGWQWMFMLEGLPAVAFAWVVWR 199 +R RA FL G A+I+ GP+ L+++DG G GWQWMF++EG+ +V VW Sbjct: 149 SERGRAMAIFLSGSALASILSGPISGGLLQIDGG-GLQGWQWMFIIEGMASVLLCGFVWF 207 Query: 200 KLPDRPSKAPWLSAEEARGIEQRIAQETEEGAGEGGHSL---KNWLTPQILLAIFVYFCH 256 L P+ A WL+A+E I + I E E + + PQIL+ F+YF Sbjct: 208 WLDSMPADAKWLTAQERSAITRAIVDEQAERMKHQPAQVSPRQLLRDPQILIFCFIYFSI 267 Query: 257 QITIYTVIFFLPSIISKYGELSTMSVGLLTSLPWIAAALGALLIPRFATTPGRCRRLLVT 316 +TIY F+LPSII K G S VGL S+PW+ + + A + T Sbjct: 268 SLTIYGATFWLPSIIRKMGSFSDFQVGLFNSIPWLISIVAMYAFAALAARFKHQQAWAAT 327 Query: 317 GLLTMALGLGIASVSGPVFSLLGFCLSAVMFFVVQSIIFLYPASRLKGVALAGGLGFVNA 376 L+ A G+ ++ V++ + C +AV F S+ + P + L AG + +N+ Sbjct: 328 ALVIAAAGMFASTFGNSVYAFVSICFAAVGFKAASSLFWPLPQAYLDARIAAGVIALINS 387 Query: 377 CGLLGGFVGPSVMGVIEQSTGNAMNGLKVIALVLVVAALAALRLRMG 423 G LGGFV P+ G +EQ TG+ GL +A+ +VAA R G Sbjct: 388 IGNLGGFVAPTAFGFLEQRTGSIQGGLMGLAITSLVAAGVVFLARSG 434 Lambda K H 0.327 0.141 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 542 Number of extensions: 33 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 438 Length of database: 442 Length adjustment: 32 Effective length of query: 406 Effective length of database: 410 Effective search space: 166460 Effective search space used: 166460 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory