Align cytochrome c component of deoxyribose dehydrogenase (characterized)
to candidate HSERO_RS16735 HSERO_RS16735 alcohol dehydrogenase
Query= reanno::WCS417:GFF2133 (447 letters) >FitnessBrowser__HerbieS:HSERO_RS16735 Length = 444 Score = 394 bits (1012), Expect = e-114 Identities = 206/448 (45%), Positives = 276/448 (61%), Gaps = 29/448 (6%) Query: 7 ARTAGWLALPCLVAAGLLAWYVTREPATPFEQEQAGATFEPALVSRGEYVARLSDCVACH 66 A A ++L L AA PA P +Q LV RGEY+A+ DCVACH Sbjct: 11 AACAAVMSLSALTAAA------QSNPAAPSADQQ--------LVQRGEYLAKAGDCVACH 56 Query: 67 SLAGKAPFAGGLEMATPLGAIHATNITPDKSTGIGTYSLADFDRAVRHGVAPGGRRLYPA 126 + G PFAGGL +ATP+G ++++NITPDK GIG YS DFDRA+RHG+ G LYPA Sbjct: 57 TAKGGKPFAGGLAIATPIGTVYSSNITPDKENGIGNYSEEDFDRALRHGIRKDGASLYPA 116 Query: 127 MPYPSYVKLSDDDIKALYAFFMQGIKPANQPNIPSDIPWPLNMRWPIALWNGVFAPTATY 186 MPYPSY K+ D+KALYA+FM G++ PN DI WPL+MRWP+++W VFAP A Sbjct: 117 MPYPSYAKVKPADVKALYAYFMHGVQADPAPNRGVDITWPLSMRWPLSIWRKVFAP-AVA 175 Query: 187 AAKPDQDALWNRGAYIVQGPGHCGSCHTPRGLAFNEKALDEAGAPFLAGALLDGWYAPSL 246 P+ ++ RG Y+V+G GHCG+CHTPRG+ EKAL + FL+G ++DG+ A +L Sbjct: 176 VDGPEDNSPLVRGQYLVEGLGHCGACHTPRGVGMQEKALSNDSSQFLSGGVIDGYLANNL 235 Query: 247 RQDPNTGLGRWSEPQIVQFLKTGRNAHAVVYGSMTEAFNNSTQFMQDDDLAAIARYLKSL 306 R D GLG WSE IV FLKTGRN+H+ +G M + NSTQ+M ++DL+A+A+YLKSL Sbjct: 236 RGDGRDGLGNWSEADIVAFLKTGRNSHSAAFGGMADVVANSTQYMTEEDLSAMAKYLKSL 295 Query: 307 PGDPQRDGAP------WQYQAVAAVQD-APGAHTYATRCASCHGLDGKGQPEWMPPLAGA 359 P +DG P +QA+ D +PGA + CA+CH GKG E P LA + Sbjct: 296 --KPVKDGTPALAYDDKTHQALRKGSDQSPGAMAFLNNCAACHRSSGKGYDETFPSLALS 353 Query: 360 TSALAKESASAINITLNGSQRVVASGVPDAYRMPAFREQLSDTEIAEVLSYVRSTWGNNG 419 + A+ AS I I L G++ P + MPAF +LSD E+AEV++++RS+WGN Sbjct: 354 PTVNAENPASLIRIVLEGAEMPWTHKAPTQFAMPAFGSRLSDQEVAEVVTFIRSSWGNQA 413 Query: 420 GAVDANAVGKLRGH-----TDPASSSPI 442 +V A+ V K+R T A S+P+ Sbjct: 414 SSVSASDVAKVRKQLPEKKTVEAGSAPV 441 Lambda K H 0.318 0.133 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 615 Number of extensions: 25 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 447 Length of database: 444 Length adjustment: 32 Effective length of query: 415 Effective length of database: 412 Effective search space: 170980 Effective search space used: 170980 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory