Align cytochrome c component of deoxyribose dehydrogenase (characterized)
to candidate HSERO_RS22390 HSERO_RS22390 alcohol dehydrogenase
Query= reanno::WCS417:GFF2133 (447 letters) >FitnessBrowser__HerbieS:HSERO_RS22390 Length = 466 Score = 373 bits (957), Expect = e-108 Identities = 187/408 (45%), Positives = 255/408 (62%), Gaps = 11/408 (2%) Query: 40 QAGATFEPALVSRGEYVARLSDCVACHSLAGKAPFAGGLEMATPLGAIHATNITPDKSTG 99 Q A+ E + RG Y+AR DCVACH+ G APFAGGL +A+P+GAI++TNITPDK G Sbjct: 57 QGSASAEDQQILRGAYLARAGDCVACHTSKGGAPFAGGLALASPIGAIYSTNITPDKQHG 116 Query: 100 IGTYSLADFDRAVRHGVAPGGRRLYPAMPYPSYVKLSDDDIKALYAFFMQGIKPANQPNI 159 IG +S DF R +R GV G +YPAMPYPSY +L+D+D++ALYA+F + + P+ Q N Sbjct: 117 IGDWSYEDFARLMRTGVTKAGYTVYPAMPYPSYSRLTDEDMQALYAYFSKAVPPSAQENR 176 Query: 160 PSDIPWPLNMRWPIALWNGVFAPT-ATYAAKPDQDALWNRGAYIVQGPGHCGSCHTPRGL 218 +DIPWPL+MRWP+ALW VFAPT A Y D RGAY+V+G GHCGSCH+PR + Sbjct: 177 ANDIPWPLSMRWPLALWRKVFAPTPAPYTPAAGSDQELARGAYLVEGLGHCGSCHSPRAV 236 Query: 219 AFNEKAL-DEAGAPFLAGA-LLDGWYAPSLRQDPNTGLGRWSEPQIVQFLKTGRNAHAVV 276 EKAL ++ G FL+G ++DGW PSLR + G+ WS+ +V+FL+TGRN + Sbjct: 237 TMQEKALKEDGGRLFLSGGQVVDGWSVPSLRNEHGGGIAGWSQADLVEFLRTGRNQYTAS 296 Query: 277 YGSMTEAFNNSTQFMQDDDLAAIARYLKSLPGDPQRDGAPWQYQAVAAV------QDAPG 330 +G+M + +S Q+M D DL A+ARYL SLP P++ AP++Y + A D PG Sbjct: 297 FGAMNDVIEDSMQYMSDADLNAMARYLLSLP--PRQQAAPYRYDSATAQAAYDGRPDGPG 354 Query: 331 AHTYATRCASCHGLDGKGQPEWMPPLAGATSALAKESASAINITLNGSQRVVASGVPDAY 390 A Y RCA+CH +G G + P LAG ++ SAI I L G ++ + Sbjct: 355 ARIYLDRCAACHRSNGTGYGKAFPALAGNPVLQTSDATSAIRIILQGGRQPSTASATAGL 414 Query: 391 RMPAFREQLSDTEIAEVLSYVRSTWGNNGGAVDANAVGKLRGHTDPAS 438 M + + L D ++AEV SY+++ WGN GG A V K+R P + Sbjct: 415 VMAPYAQLLDDQQVAEVTSYIQTAWGNRGGTTTAAEVAKVRKTAVPVA 462 Lambda K H 0.318 0.133 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 658 Number of extensions: 35 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 447 Length of database: 466 Length adjustment: 33 Effective length of query: 414 Effective length of database: 433 Effective search space: 179262 Effective search space used: 179262 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory