Align aldehyde dehydrogenase ALDH; EC 1.2.1.3 (characterized)
to candidate HSERO_RS19755 HSERO_RS19755 betaine-aldehyde dehydrogenase
Query= CharProtDB::CH_007936 (497 letters) >lcl|FitnessBrowser__HerbieS:HSERO_RS19755 HSERO_RS19755 betaine-aldehyde dehydrogenase Length = 484 Score = 395 bits (1016), Expect = e-114 Identities = 214/472 (45%), Positives = 294/472 (62%), Gaps = 7/472 (1%) Query: 22 FINNEFVKGVEGKTFQVINPSNEKVITSVHEATEKDVDVAVAAARAAFEG-PWRQVTPSE 80 FI E + +G+ ++NP NE++ S + T DV AVAAA+A EG W +++ + Sbjct: 8 FIAGEATEASDGQRMNLVNPINEEIYASAAQGTAADVARAVAAAKAQLEGGAWSKLSGLQ 67 Query: 81 RGILINKLADLMERDIDTLAAIESLDNGKA-FTMAKVDLANSIGCLRYYAGWADKIHGQT 139 RG L++KLA L+ERD D LA +++ G++ +D+ N+I LR AGWA+++ G+T Sbjct: 68 RGQLLHKLAALVERDTDLLADMDARAIGRSPMEPRMMDVPNAISHLRAAAGWANQMEGRT 127 Query: 140 IDT----NPETLTYTRHEPVGVCGQIIPWNFPLLMWSWKIGPAVAAGNTVVLKTAEQTPL 195 I T TL+YT EP+GV G I+PWN PL++ SWK+ +AAG TVV+K AE+TP Sbjct: 128 IPTAGYMGKPTLSYTVREPIGVVGAILPWNAPLMITSWKVAALLAAGCTVVIKPAEETPQ 187 Query: 196 SALYAAKLIKEAGFPAGVINVISGFGRTAGAAISSHMDIDKVAFTGSTLVGRTILQAAAK 255 SAL+ A+L +EAGFP GVINV++G+G + G A+ H D+ K++FTGS GR I Q A Sbjct: 188 SALHLARLAQEAGFPDGVINVVTGYGNSVGRALCEHPDVAKISFTGSPEAGRAI-QRIAG 246 Query: 256 SNLKKVTLELGGKSPNIVFDDADIDNAISWANFGIFFNHGQCCCAGSRILVQEGIYDKFV 315 K+VTLELGGKSP IVFDDA ++A+ G+F N GQ C AGSRILVQ + +F Sbjct: 247 EQFKRVTLELGGKSPQIVFDDAPFEDALFGCTLGLFVNQGQVCAAGSRILVQRSLAQRFA 306 Query: 316 ARFKERAQKNKVGNPFEQDTFQGPQVSQLQFDRIMEYINHGKKAGATVATGGDRHGNEGY 375 E A VG+P + GP + QF+R+ YI G GAT+ GG ++G+ Sbjct: 307 KALAEAAAGITVGDPSQPGVRMGPVAKKAQFERVNRYIQQGLDEGATLLAGGVSRPDKGW 366 Query: 376 FIQPTVFTDVTSDMKIAQEEIFGPVVTIQKFKDEAEAIKIGNSTDYGLAAAVHTKNVNTA 435 F+QPT+F D + M IA+EEIFGPV TI F E EAI + N + YGLAA V T N+ A Sbjct: 367 FVQPTIFADANNGMSIAREEIFGPVGTIISFDTEEEAIALANDSKYGLAATVWTTNLARA 426 Query: 436 IRVSNALKAGTVWINNYNMISYQAPFGGFKQSGLGRELGSYALENYTQIKTV 487 RV+ +K G V +N ++ + P+GG K SG+GRE G YT+ KTV Sbjct: 427 HRVAAGVKVGAVGVNCWSPLDANLPWGGIKDSGMGREGGLAGALAYTEEKTV 478 Lambda K H 0.318 0.134 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 554 Number of extensions: 23 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 497 Length of database: 484 Length adjustment: 34 Effective length of query: 463 Effective length of database: 450 Effective search space: 208350 Effective search space used: 208350 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory