Align Xylose ABC transporter, periplasmic xylose-binding protein XylF (characterized, see rationale)
to candidate HSERO_RS05315 HSERO_RS05315 LacI family transcriptional regulator
Query= uniprot:A0A0C4Y591 (325 letters) >FitnessBrowser__HerbieS:HSERO_RS05315 Length = 302 Score = 145 bits (365), Expect = 2e-39 Identities = 96/295 (32%), Positives = 156/295 (52%), Gaps = 6/295 (2%) Query: 21 AAAQSAPDAAPASAAAQRPLKKVGVTLGSLGNPYFVALAHGAEAAAKKINPDAKVTVLSA 80 A A + AAPA A LK +G++ + NPYFV++ + AAK + AKV A Sbjct: 7 ALALTTLAAAPAMAQEVSKLK-IGMSFQEMNNPYFVSMKKALDEAAKSLG--AKVIATDA 63 Query: 81 DYDLNKQFSHIDSFIVSKVDLILINAADARAIEPAVRKARKAGIVVVAVDVAAAG-ADAT 139 +++ KQ + I+ + +D++LIN D+ +E AV+ A+ ++VVAVD A+G D Sbjct: 64 AHNVAKQIADIEDMLQQNIDILLINPTDSAGVEAAVKAAKARNVIVVAVDANASGPVDMF 123 Query: 140 VQTDNTRAGELACAFLAGRLGGRGNLIIQNGPPVSAVLDRVKGCKMVLGKHPGIHVLSDD 199 V + N AG +C LA +GG+G + I +G PV +L RV+GCK L ++ I +++ Sbjct: 124 VGSKNKDAGYQSCRALADAIGGKGEVAILDGIPVVPILQRVEGCKQALAEYKDIKLVA-T 182 Query: 200 QDGKGSREGGLNVMQLYLTRFPKIDAVFTINDPQAVGADLAARQLNRGGILIASVDGAPD 259 Q+G+ R L V++ + P + +F++ND A+GA LAA Q + I + SVDGAP+ Sbjct: 183 QNGRQDRSVALGVVENMIQSRPNLKGIFSVNDGGAMGA-LAAIQGSGKDIKLTSVDGAPE 241 Query: 260 IEAALKANTLVQASASQDPWAIARTAVEIGVGLMHGQAPANRTVLLPPTLVTRAN 314 A+ + +Q P R + + + G + V + VT+ N Sbjct: 242 AVKAIADGGPFVETTAQFPRDQVRVGLAMALAKKWGARVVPKEVPIDVMPVTKKN 296 Lambda K H 0.318 0.132 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 161 Number of extensions: 15 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 325 Length of database: 302 Length adjustment: 27 Effective length of query: 298 Effective length of database: 275 Effective search space: 81950 Effective search space used: 81950 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory