Align Ribose ABC transport system, permease protein RbsC (characterized, see rationale)
to candidate HSERO_RS05255 HSERO_RS05255 ribose ABC transporter permease
Query= uniprot:A0A0C4Y7K0 (337 letters) >FitnessBrowser__HerbieS:HSERO_RS05255 Length = 347 Score = 221 bits (562), Expect = 3e-62 Identities = 134/346 (38%), Positives = 202/346 (58%), Gaps = 14/346 (4%) Query: 1 MHESITRPAASTGAPLPAGTLGRLTTQERLRALGMLPVLVLLCIGFSVLTENFAGWQNLS 60 +H + + G RL + L L+L+ + FS + NF NL Sbjct: 5 IHSATSASTTMANTASAQGLRARLFNPAARQKLLAFASLLLMILFFSFASPNFMEVDNLV 64 Query: 61 IIAQQASINMVLAAGMTFVILTGGIDLSVGSILSISAVVAMLVSLMPQLGM---LSVPAA 117 I Q ++N VLA T+VI+T GIDLSVG++++ AV+A +V + GM L + AA Sbjct: 65 SILQSTAVNGVLAIACTYVIITSGIDLSVGTMMTFCAVMAGVV--LTNWGMPLPLGIAAA 122 Query: 118 LLCGLLFGIVNGALVAFMKLPPFIVTLGTLTAVRGLARLVGNDSTIY-NPDIGFAFIGNG 176 + G L G ++G ++A +K+PPFI TLG + ++GL+ ++ IY N GF+ I Sbjct: 123 IFFGALSGWISGMVIAKLKVPPFIATLGMMMLLKGLSLVISGTRPIYFNDTEGFSAIAQD 182 Query: 177 EVLG-------VPWLVIIAFAVVAVSWFVLRRTVLGLQIYAVGGNAEAARLSGIKVWVVL 229 ++G +P V+I F V + +L +TV G +A+G N EA RLSG+KV Sbjct: 183 SLIGDLIPSLPIPNAVLILFLVAIGASIILNKTVFGRYTFALGSNEEALRLSGVKVDFWK 242 Query: 230 LFVYAVSGLLAGLGGVMSSARLYAANGLQLGQSYELDAIAAVILGGTSFVGGTGSIVGTL 289 + VY SG + G+ G++ ++RL +A LGQ YELDAIAAV++GGTS GGTG+I+GT+ Sbjct: 243 VAVYTFSGAICGIAGLIIASRLNSAQPA-LGQGYELDAIAAVVIGGTSLSGGTGTILGTI 301 Query: 290 VGALIIAVLSNGLVLLGVSDIWQYIIKGLVIIGAVALDSYRRKGSA 335 +GA I++VL NGL ++ V+ WQ ++ G++II AV LD RR+ A Sbjct: 302 IGAFIMSVLVNGLRIMSVAQEWQTVVTGVIIILAVYLDILRRRRRA 347 Lambda K H 0.325 0.141 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 355 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 337 Length of database: 347 Length adjustment: 29 Effective length of query: 308 Effective length of database: 318 Effective search space: 97944 Effective search space used: 97944 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory