Align Fructokinase; EC 2.7.1.4 (characterized)
to candidate HSERO_RS11500 HSERO_RS11500 ribokinase
Query= SwissProt::P26420 (307 letters) >FitnessBrowser__HerbieS:HSERO_RS11500 Length = 299 Score = 86.7 bits (213), Expect = 6e-22 Identities = 84/287 (29%), Positives = 127/287 (44%), Gaps = 24/287 (8%) Query: 22 RLLQCPGGAPANVAVGVARL---GGDSGFIGRVGDDPFGRFMRHTLAQEQVDVNYMRLDA 78 R + PGG AN AV ARL G + VGDD FG MR ++ +D Y+ A Sbjct: 30 RFMTIPGGKGANQAVACARLAAPGTRVAMVACVGDDAFGGQMRQSITACGIDDRYIDEVA 89 Query: 79 AQRTSTVVVDLDSHGERTFTFMVRPSADLFLQPEDLPPFAAGQWLHVCSIALSAEPSRST 138 + T + +D++ + + + L ++ + Q + L E +T Sbjct: 90 GEATGIASIMVDANAQNSIVIAAGANGRLDVERIERARALIEQ---ASIVLLQLEVPMAT 146 Query: 139 TFAALEAIKRAGGYVSFDPNIRSDLWQDPQDLRDCLDRA-LALADAIKLSEEELAFISGS 197 ++E G V +P L P+ L +D L +A L+EE+ S Sbjct: 147 VIHSIELAHALGKTVVLNPAPAQAL---PRALLQKIDYLILNEIEAAMLAEEQ------S 197 Query: 198 DDIVSGIARLNARFQPTLLLVTQGKAGVQAALR-GQVSHFPARPVVAVDTTGAGDAFVAG 256 +DI +AR ++VT G+ GV + GQ H PAR V AVDTT AGD F+ G Sbjct: 198 EDIPM-LARKLHDLGARNVVVTLGEKGVYGSFADGQQRHLPARKVQAVDTTAAGDTFIGG 256 Query: 257 LLAGLAAHGIPDNLAALAPDLALAQTCGALATTAKGAMTALPYKDDL 303 + +A D A +A AQ AL+ T GA T++P +D++ Sbjct: 257 FIGAIAQG--RDQFEA----IAYAQAAAALSVTRVGAQTSIPTRDEV 297 Lambda K H 0.321 0.137 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 155 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 299 Length adjustment: 27 Effective length of query: 280 Effective length of database: 272 Effective search space: 76160 Effective search space used: 76160 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory