GapMind for catabolism of small carbon sources

 

Aligments for a candidate for BPHYT_RS34240 in Herbaspirillum seropedicae SmR1

Align Monosaccharide-transporting ATPase; EC 3.6.3.17; Flags: Precursor (characterized, see rationale)
to candidate HSERO_RS22215 HSERO_RS22215 branched-chain amino acid ABC transporter permease

Query= uniprot:B2T9V8
         (351 letters)



>lcl|FitnessBrowser__HerbieS:HSERO_RS22215 HSERO_RS22215
           branched-chain amino acid ABC transporter permease
          Length = 323

 Score =  154 bits (389), Expect = 3e-42
 Identities = 103/304 (33%), Positives = 160/304 (52%), Gaps = 12/304 (3%)

Query: 41  LALLPALALLIVIGAFISPSFLTKANLISVLGASAALALVVLAESLIVLTGKFDLSLEST 100
           LALL  + +L+V     +P FL+  ++ ++L  SA   ++ LA+ L++LT   DLS+ S 
Sbjct: 2   LALLTVVLILLV--GVRAPVFLSAQSMDNLLTDSAITIMLALAQMLVILTRGIDLSVASN 59

Query: 101 VGIAPAVGAMLVMPAASAGFGMQWPAAAGLLAIVVVGAVIGFINGFLVVRLRLNAFIVTL 160
           + ++  + A+L M   +       P    +L  V++G ++G +NG+L+  L L   +VTL
Sbjct: 60  LALSGMMSALLAMHFPAL------PVGVFILMAVLIGLMLGLLNGWLIGYLELPPIVVTL 113

Query: 161 AMLIVLRGMLVGATKGGTLF--DMPTSFFALATTIVLGLPLSVWLAAAAFAIAAFMLRYH 218
             + V RGM+   + G  +   +MP  F A     + GL   VWL A A     F+ R+ 
Sbjct: 114 GSMSVYRGMVFVLSGGAWVSSRNMPADFIAFPLARLGGLTHLVWLGALAVVAIWFLARHT 173

Query: 219 RLGRALYAIGGNPEAARAAGIRVE-RITWGVFVLGSILASVGGLIVTGYVGAINANQGNG 277
           R GR LYAIG +P AA   GI    R+ W   + G++    G L V  Y  A       G
Sbjct: 174 RFGRDLYAIGNDPAAAAYVGIASRGRLLWTYGLSGAMAGLAGYLWVARYAVAY-TEIAYG 232

Query: 278 MIFTVFAAAVIGGISLDGGKGTMFGALTGVLLLGVVQNLLTLAQVPSFWIQAIYGAIILG 337
              TV AA VIGG+S+ GG G + GA+ G L L V+ N L + ++  FW  A+ G +IL 
Sbjct: 233 FELTVIAACVIGGVSIAGGVGQVSGAVLGALFLSVINNALPIMRISPFWQSALTGLVILC 292

Query: 338 SLMV 341
           ++++
Sbjct: 293 AVVL 296


Lambda     K      H
   0.326    0.140    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 248
Number of extensions: 13
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 351
Length of database: 323
Length adjustment: 28
Effective length of query: 323
Effective length of database: 295
Effective search space:    95285
Effective search space used:    95285
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 49 (23.5 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory