Align ABC-type sugar transport system, permease component protein (characterized, see rationale)
to candidate HSERO_RS05325 HSERO_RS05325 ribose ABC transporter permease
Query= uniprot:D8J112 (347 letters) >FitnessBrowser__HerbieS:HSERO_RS05325 Length = 328 Score = 224 bits (571), Expect = 2e-63 Identities = 123/333 (36%), Positives = 198/333 (59%), Gaps = 12/333 (3%) Query: 6 HSATSASTTMANTASAQGLRARLFNPAARQKLLAFASLLLMILFFSFASPNFMEVDNLVS 65 H A + +TA++ R+ + +P A L A L+++ L AS NF + N + Sbjct: 3 HDANALPAASLHTAASARWRSLIHSPLA----LPLAGLVVVSLLMGLASDNFFTLSNWFN 58 Query: 66 ILQSTAVNGVLAIACTYVIITSGIDLSVGTMMTFCAVMAGVVLTNWGMPLPLGIAAAIFF 125 +L+ ++ G+LA+ ++VI+T GIDLSVG M ++ ++ N G+P PL + + Sbjct: 59 VLRQVSIVGILAVGMSFVILTGGIDLSVGAAMALAGTISAGLIVNSGLPAPLALLCGVGL 118 Query: 126 GALSGWISGMVIAKLKVPPFIATLGMMMLLKGLSLVISGTRPIYFNDTEGFSAIAQDSLI 185 G ++G ++A ++P I TL M + +G+ L+ SG PI + G+ + I Sbjct: 119 ATCIGLLNGALVAWGRMPAIIVTLATMGVARGVGLIYSGGYPI--SGLPGWISWFGVGRI 176 Query: 186 GDLIPSLPIPNAVLILFLVAIGASIILNKTVFGRYTFALGSNEEALRLSGVKVDFWKVAV 245 G +P+P V+++ +V A ++L +T FGR+ +A+G NE A RLSGVK K+AV Sbjct: 177 G----MVPVP--VILMLIVYALAWLLLQRTAFGRHVYAIGGNEMAARLSGVKTTRIKLAV 230 Query: 246 YTFSGAICGIAGLIIASRLNSAQPALGQGYELDAIAAVVIGGTSLSGGTGTILGTIIGAF 305 Y SG G+A +I+ RL S QP G G+ELDAIAAVV+GGT+++GG G ++GT+IGA Sbjct: 231 YAISGFTSGLAAIILTGRLMSGQPNAGVGFELDAIAAVVLGGTAIAGGRGLVVGTLIGAV 290 Query: 306 IMSVLVNGLRIMSVAQEWQTVVTGVIIILAVYL 338 ++ +L NGL +M + Q ++ GVII+LA+Y+ Sbjct: 291 LLGILNNGLNLMGINPYLQDIIRGVIILLAIYI 323 Lambda K H 0.326 0.139 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 299 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 347 Length of database: 328 Length adjustment: 28 Effective length of query: 319 Effective length of database: 300 Effective search space: 95700 Effective search space used: 95700 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory