Align ABC transporter for L-Fucose, permease component 1 (characterized)
to candidate HSERO_RS16725 HSERO_RS16725 ABC transporter permease
Query= reanno::Smeli:SM_b21104 (298 letters) >FitnessBrowser__HerbieS:HSERO_RS16725 Length = 299 Score = 130 bits (328), Expect = 3e-35 Identities = 87/275 (31%), Positives = 132/275 (48%), Gaps = 5/275 (1%) Query: 11 LLLLPAFIVLAVFIVLPLIFSLYSSFTPFRLTKPDSLWVFIGFRNYVNVLTNAEFWVAFG 70 L + PA I+L VF+ PL ++ FT ++ S FIG N+ + ++ ++ Sbjct: 15 LFMAPAVILLVVFLTYPLGLGIWLGFTDTKIGGEGS---FIGLDNFTYLAGDSLAQLSLF 71 Query: 71 RTVLLLTVALNAEMFLGLGLALLVNKATYGQRALRTAMMFPMMFSPVLVGFQFKFLFNDN 130 TV A + LGL LA+L+NK + R ++ P + L F +L++ Sbjct: 72 NTVFYTVSASILKFMLGLWLAILLNKNVPLKTFFRAIVLLPWIVPTALSALAFWWLYDAQ 131 Query: 131 IGFVNNALQSLGLTDRAIPWLIDGNLALFSIIVAEVWSSTAVFAILILAGLLAMPKDPVE 190 ++ AL +GL DR I +L D A +S + A VW AI +LAGL + E Sbjct: 132 FSVISWALHKMGLIDRYIDFLGDPWNARWSTVFANVWRGIPFVAISLLAGLQTISPSLYE 191 Query: 191 AAHVDGCTPWQTFRYVTWPYLMPFAFIAMTIRSLDVARAYDIVKIMTDGGPAKRTELLWT 250 AA +DG TPWQ FR+VT P L P + MT L + ++ ++T GGP T L+ T Sbjct: 192 AAAIDGATPWQQFRHVTLPLLTPIIAVVMTFSVLFTFTDFQLIYVLTRGGPLNATHLMAT 251 Query: 251 LIGRTAYGDARMGMANAMA--YVAILLSIFFTVYF 283 L + A +G A+A + LL+ YF Sbjct: 252 LSFQRAIPGGALGEGAALATYMIPFLLAAIMFSYF 286 Lambda K H 0.331 0.142 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 309 Number of extensions: 18 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 298 Length of database: 299 Length adjustment: 27 Effective length of query: 271 Effective length of database: 272 Effective search space: 73712 Effective search space used: 73712 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory