Align ABC transporter for L-Fucose, ATPase component (characterized)
to candidate HSERO_RS18940 HSERO_RS18940 sn-glycerol-3-phosphate ABC transporter ATP-binding protein
Query= reanno::Smeli:SM_b21106 (365 letters) >FitnessBrowser__HerbieS:HSERO_RS18940 Length = 364 Score = 348 bits (892), Expect = e-100 Identities = 195/372 (52%), Positives = 244/372 (65%), Gaps = 18/372 (4%) Query: 1 MAPVTLKKLVKRYGA----LEVVHGIDLEVKDREFIALVGPSGCGKSTTLRMIAGLEEVS 56 MA + LK++ K YGA ++V+HGID E+ D EFI +VGPSGCGKST LRM+AGLEE+S Sbjct: 1 MAAIHLKQVRKTYGAGTKAVDVIHGIDAEIADGEFIVMVGPSGCGKSTLLRMVAGLEEIS 60 Query: 57 GGAIEIGGRKVNDLPPRARNISMVFQSYALYPHMTVAENMGFSLKIAGRPAEEIKTRVAE 116 G I IG R VNDL P+ R+I+MVFQ+YALYPHMTV +NM + LKI G EI RV Sbjct: 61 SGQIVIGDRVVNDLEPKERDIAMVFQNYALYPHMTVYQNMAYGLKIQGLSKSEIDARVQR 120 Query: 117 AAAILDLAHLLERRPSQLSGGQRQRVAMGRAIVRQPDVFLFDEPLSNLDAKLRTQVRTEI 176 AAAIL+L LLER P QLSGGQRQRVAMGRAIVR+P VFLFDEPLSNLDAKLR Q+R EI Sbjct: 121 AAAILELGALLERTPRQLSGGQRQRVAMGRAIVRKPAVFLFDEPLSNLDAKLRVQMRLEI 180 Query: 177 KKLHARMQATMIYVTHDQVEAMTLSDRIVIMRDGHIEQVGTPEDVFRRPATKFVAGFIGS 236 +KLHA ++ T +YVTHDQVEAMTL R+++M G EQ+GTP +V+ RPAT FVA FIGS Sbjct: 181 QKLHASLRTTSLYVTHDQVEAMTLGQRMIVMNRGVAEQIGTPAEVYARPATTFVASFIGS 240 Query: 237 PPMNMEEAVLTDGKLAFA-----SGATLPLPPRFRSLVREGQKVTFGLRPDDVYPSGHGL 291 PPMN+ + L+ +F + L LP GQ+ G+RP+ + P G Sbjct: 241 PPMNLLQGKLSADGASFEVSKGNASDILRLPQPLTGAA--GQERILGVRPEHLLPILDGS 298 Query: 292 HAGDADAVHEIELPVTITEPLGNETLVFTQFNGRDWVSRMLNPRPLRPGEAVPMSFDLAR 351 A ++ L V + E LG E LV + G+ V R +R G+ + SF Sbjct: 299 AA-------QLSLEVELVEALGAELLVHARCGGQALVLRCPANVQVRTGQRIGASFGAGD 351 Query: 352 AHLFDGETGRAL 363 H FD ++ R + Sbjct: 352 VHWFDVKSTRRI 363 Lambda K H 0.320 0.137 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 383 Number of extensions: 15 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 364 Length adjustment: 29 Effective length of query: 336 Effective length of database: 335 Effective search space: 112560 Effective search space used: 112560 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory