GapMind for catabolism of small carbon sources

 

Aligments for a candidate for aldA in Herbaspirillum seropedicae SmR1

Align NAD(P)+ L-lactaldehyde dehydrogenase (EC 1.2.1.22) (characterized)
to candidate HSERO_RS04810 HSERO_RS04810 aldehyde dehydrogenase

Query= metacyc::MONOMER-16244
         (495 letters)



>lcl|FitnessBrowser__HerbieS:HSERO_RS04810 HSERO_RS04810 aldehyde
           dehydrogenase
          Length = 504

 Score =  334 bits (856), Expect = 5e-96
 Identities = 183/473 (38%), Positives = 264/473 (55%), Gaps = 3/473 (0%)

Query: 22  GLFINNEFVQSKSKKTFGTVSPSTEEEITQVYEAFSEDIDDAVEAATAAFHSSWSTSDPQ 81
           G +IN E V  + +      +P+T        +  +  ++ A  AA  A    W+ S   
Sbjct: 24  GSWINGELVAGQGE-IIQLYNPATGRASLSYRDGGAAAVEAAAVAAQRAQRQWWALSHA- 81

Query: 82  VRMKVLYKLADLIDEHADTLAHIEALDNGKSLMCSKGDVALTAAYFRSCAGWTDKIKGSV 141
            R + LY +  +I   A+ LA +EA+ +GK +   + ++   A  F   AGW DK  G V
Sbjct: 82  ARGRALYAVGAVIRAEAEPLARLEAISSGKPIRDCRAEMQKVAEMFEYYAGWADKFYGEV 141

Query: 142 IETGDTHFNYTRREPIGVCGQIIPWNFPLLMASWKLGPVLCTGCTTVLKTAESTPLSALY 201
           I    +H NYTRREP G   Q+ PWN P     W+LGP L TG   +LK +E TP S+L 
Sbjct: 142 IPVPSSHLNYTRREPYGTVLQMTPWNAPAFTCGWQLGPALATGNAVLLKPSELTPFSSLA 201

Query: 202 LASLIKEAGAPPGVVNVVSGFGPTAGAPISSHPKIKKVAFTGSTATGRHIMKAAAESNLK 261
           +A L ++AG P G+VNV++G G T      +   +KKV F GS ATG  I KAAA + + 
Sbjct: 202 IARLGEQAGLPAGLVNVLAGLGQTMVPQAMATWTVKKVIFVGSPATGALIAKAAA-ARVM 260

Query: 262 KVTLELGGKSPNIVFDDADVKSTIQHLVTGIFYNTGEVCCAGSRIYVQEGIYDKIVSEFK 321
              LELGGKS NI+F+DAD++         IF   G+ C AGSR+ VQ  +YD+ V    
Sbjct: 261 PCVLELGGKSANIIFEDADLRLAAFGAQAAIFSGAGQSCVAGSRLLVQRKVYDRFVETVA 320

Query: 322 NAAESLKIGDPFKEDTFMGAQTSQLQLDKILKYIDIGKKEGATVITGGERFGNKGYFIKP 381
             AE +++G P  + T +G   ++ Q + I + +  G + GAT+  G  R+G +GYF++P
Sbjct: 321 AGAEKIRLGAPLDDSTEVGPINNRKQYEHIQRMVARGLEAGATLAAGHTRYGEEGYFVRP 380

Query: 382 TIFGDVKEDHQIVRDEIFGPVVTITKFKTVEEVIALANDSEYGLAAGVHTTNLSTAISVS 441
           T+        ++ R EIFGPV     F+  EE IA+ANDSE+GLA  V T +++ A  V+
Sbjct: 381 TLLAHASNAMEVARSEIFGPVAVAIPFEDEEEAIAIANDSEFGLAGAVWTRDVARAHRVA 440

Query: 442 NKINSGTIWVNTYNDFHPMVPFGGYSQSGIGREMGEEALDNYTQVKAVRIGLS 494
             +N+GT WVN+Y   +   PFGG+++SG GR  G EAL +YTQ K+V +  S
Sbjct: 441 ASVNAGTFWVNSYKTINVASPFGGFNRSGYGRSSGMEALYDYTQTKSVWVETS 493


Lambda     K      H
   0.316    0.133    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 622
Number of extensions: 24
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 495
Length of database: 504
Length adjustment: 34
Effective length of query: 461
Effective length of database: 470
Effective search space:   216670
Effective search space used:   216670
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory