Align 2-keto-3-deoxy-L-fuconate dehydrogenase; EC 1.1.1.- (characterized)
to candidate HSERO_RS12375 HSERO_RS12375 3-oxoacyl-ACP reductase
Query= SwissProt::Q8P3K4 (300 letters) >FitnessBrowser__HerbieS:HSERO_RS12375 Length = 261 Score = 123 bits (309), Expect = 4e-33 Identities = 81/248 (32%), Positives = 126/248 (50%), Gaps = 13/248 (5%) Query: 56 RLQGKRCLITAAGAGIGRESALACARAGAHVIATDIDAAALQAL--AAESDAITTQLLDV 113 R +GK ++T A +GIG +A + GA V+ D DAAAL + + + + DV Sbjct: 11 RFEGKVVIVTGAASGIGEATARRFSDEGARVLLADRDAAALGKVFDSLPPERTAARETDV 70 Query: 114 TDAAAITALV----AAHGPFDVLFNCAGYVHQGSILDCDEPAWRRSFSINVDAMYYTCKA 169 + + LV G DVL + AG +G++ + W R + NV+ ++Y + Sbjct: 71 SHHEQVRQLVDFAIERFGQLDVLVSDAGVFAEGNVTEVSPEDWHRVQATNVNGVFYGARE 130 Query: 170 VLPGMLERGRGSIINMSSVASSIKGVPNRFVYGVTKAAVIGLSKAIAADYVAQGVRCNAI 229 LP LE+ RG I+N++SV S + N Y +K AV L++A+A D+ +GVR NA+ Sbjct: 131 ALPH-LEKTRGCIVNVASV-SGLAADWNLSAYNASKGAVCNLTRAMALDFGRKGVRINAV 188 Query: 230 CPGTIKTPSLGQRVQALGGDEQAVWKSFTDRQPMGRLGDPREIAQLVVYLASDESSFTTG 289 CP T D+ + F +R +GR DP EIA ++ +LAS ++SF G Sbjct: 189 CPSLTHTAMTADMA-----DDPPLLDKFAERIALGRGADPLEIAAVITFLASPDASFVNG 243 Query: 290 QTHIIDGG 297 +DGG Sbjct: 244 VNLPVDGG 251 Lambda K H 0.320 0.133 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 123 Number of extensions: 6 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 300 Length of database: 261 Length adjustment: 26 Effective length of query: 274 Effective length of database: 235 Effective search space: 64390 Effective search space used: 64390 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory