Align Monosaccharide-transporting ATPase; EC 3.6.3.17 (characterized, see rationale)
to candidate HSERO_RS05325 HSERO_RS05325 ribose ABC transporter permease
Query= uniprot:B2SYR4 (338 letters) >FitnessBrowser__HerbieS:HSERO_RS05325 Length = 328 Score = 199 bits (506), Expect = 8e-56 Identities = 106/293 (36%), Positives = 178/293 (60%), Gaps = 13/293 (4%) Query: 43 VVMFATMSLTVDHFFSIENMLGLALSISQIGMVSCTMMFCLASRDFDLSVGSTVAFAGVL 102 VV+ M L D+FF++ N + +S +G+++ M F + + DLSVG+ +A AG + Sbjct: 37 VVVSLLMGLASDNFFTLSNWFNVLRQVSIVGILAVGMSFVILTGGIDLSVGAAMALAGTI 96 Query: 103 CA-MVLNATGNTFIAIVAAVAAGGVIGFVNGAVIAYLRINALITTLATMEIVRGLGFIVS 161 A +++N+ +A++ V IG +NGA++A+ R+ A+I TLATM + RG+G I S Sbjct: 97 SAGLIVNSGLPAPLALLCGVGLATCIGLLNGALVAWGRMPAIIVTLATMGVARGVGLIYS 156 Query: 162 HGQAVGVSSDTFIALGGLSFFGVS------LPIWVTLLCFIVFGVMLNQTVYGRNTLAIG 215 G + G +S+FGV +P+ + L+ + + ++L +T +GR+ AIG Sbjct: 157 GGYPISGLP------GWISWFGVGRIGMVPVPVILMLIVYALAWLLLQRTAFGRHVYAIG 210 Query: 216 GNPEASRLAGINVERTRVYIFLIQGAVTALAGVILASRITSGQPNAAQGFELNVISACVL 275 GN A+RL+G+ R ++ ++ I G + LA +IL R+ SGQPNA GFEL+ I+A VL Sbjct: 211 GNEMAARLSGVKTTRIKLAVYAISGFTSGLAAIILTGRLMSGQPNAGVGFELDAIAAVVL 270 Query: 276 GGVSLLGGRATISGVVIGVLIMGTVENVMNLMNIDAFYQYLVRGAILLAAVLL 328 GG ++ GGR + G +IG +++G + N +NLM I+ + Q ++RG I+L A+ + Sbjct: 271 GGTAIAGGRGLVVGTLIGAVLLGILNNGLNLMGINPYLQDIIRGVIILLAIYI 323 Lambda K H 0.326 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 338 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 328 Length adjustment: 28 Effective length of query: 310 Effective length of database: 300 Effective search space: 93000 Effective search space used: 93000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory