Align UDP-glucose 4-epimerase; EC 5.1.3.2; Galactowaldenase; UDP-galactose 4-epimerase (uncharacterized)
to candidate HSERO_RS02375 HSERO_RS02375 NAD-dependent dehydratase
Query= curated2:Q56623 (328 letters) >FitnessBrowser__HerbieS:HSERO_RS02375 Length = 320 Score = 301 bits (771), Expect = 1e-86 Identities = 155/318 (48%), Positives = 211/318 (66%), Gaps = 4/318 (1%) Query: 12 ILLTGSTGFVGTNLVKSLTLKSDYIVKSAVRHA----VNKDDGLLFEVGDINASTDFELP 67 IL+TG++GFVG L+ L + ++++ A R + ++++ + ++ TD+ Sbjct: 3 ILVTGASGFVGRALLSRLDSEGQHLLRGAFRPSSETVMDRERIERTVISGLDPETDWSAA 62 Query: 68 LKNTTVVVHCAARAHVMDDKEAEPLTLYREVNTAGTVNLAKQAIDSGVKRFIFISSIKVN 127 L N VVHCAAR HVM++ +PL +R +N G++ LA+QA +GV+RFIF+SSIKVN Sbjct: 63 LHNIEAVVHCAARVHVMNETAGDPLAEFRRINLEGSLALARQAQQAGVQRFIFLSSIKVN 122 Query: 128 GEGTLVGCPFKTEDNHAPEDDYGLSKSEAEKQLVALAKDSSMEVVIIRPTIVYGPGVKAN 187 GE T +G PF +D AP D YG+SK EAE+ L+ L + M+VVIIRP +VYGPGVKAN Sbjct: 123 GEQTSLGRPFTADDKPAPTDPYGISKMEAEQALLELGRTGKMQVVIIRPVLVYGPGVKAN 182 Query: 188 FASLMRLVSKGIPLPFGSITQNKRSLVSINNLVDLIVTCIDHPKAANQVFLVSDGHDVST 247 F S+MR + KG+PLP G IT N+RSLV+++NLVDLI C+ HP AA QVFL SDG D+ST Sbjct: 183 FLSMMRWLDKGMPLPLGGITHNRRSLVALDNLVDLITVCLAHPAAAGQVFLASDGEDLST 242 Query: 248 AEMVRELAIALDKPTWQLPVPIWCYKLFGKLFGKSDIVDRLTGTLQVDISHTKETLGWKP 307 M++ L ALDK LPVP L +L GK I RL G+LQVDIS +E LGW P Sbjct: 243 TGMLQRLGRALDKSPTLLPVPASWLTLAARLMGKKGIAQRLCGSLQVDISKNRELLGWSP 302 Query: 308 PQTLQEGFKQTAQAFLQA 325 P T+ F++T A+ +A Sbjct: 303 PITVDAAFRKTVDAYRRA 320 Lambda K H 0.318 0.134 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 254 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 320 Length adjustment: 28 Effective length of query: 300 Effective length of database: 292 Effective search space: 87600 Effective search space used: 87600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory