Align UDP-glucose 4-epimerase; EC 5.1.3.2; Galactowaldenase; UDP-galactose 4-epimerase (uncharacterized)
to candidate HSERO_RS10045 HSERO_RS10045 UDP-glucose 4-epimerase
Query= curated2:P55180 (339 letters) >lcl|FitnessBrowser__HerbieS:HSERO_RS10045 HSERO_RS10045 UDP-glucose 4-epimerase Length = 343 Score = 447 bits (1150), Expect = e-130 Identities = 213/327 (65%), Positives = 260/327 (79%) Query: 3 ILVTGGAGYIGSHTCVELLNSGYEIVVLDNLSNSSAEALNRVKEITGKDLTFYEADLLDR 62 ILVTGGAGYIGSHTCVEL+++GY +VVLDNL NS A ++R+ +I+G+ F + D+ DR Sbjct: 6 ILVTGGAGYIGSHTCVELIHAGYAVVVLDNLCNSRASVIDRIAQISGQRPHFVQGDIRDR 65 Query: 63 EAVDSVFAENEIEAVIHFAGLKAVGESVAIPLKYYHNNLTGTFILCEAMEKYGVKKIVFS 122 +D +F + IEAVIHFAGLKAVGESVA PL+YY NN+ G+ +L EAM +GVK IVFS Sbjct: 66 AVLDGIFKSHRIEAVIHFAGLKAVGESVAQPLRYYDNNVHGSNVLFEAMAAHGVKNIVFS 125 Query: 123 SSATVYGVPETSPITEDFPLGATNPYGQTKLMLEQILRDLHTADNEWSVALLRYFNPFGA 182 SSATVYG P + PITE+FPL ATNPYG++KLM+EQIL DLH AD W +ALLRYFNP GA Sbjct: 126 SSATVYGDPASVPITEEFPLSATNPYGRSKLMVEQILGDLHVADPSWRIALLRYFNPVGA 185 Query: 183 HPSGRIGEDPNGIPNNLMPYVAQVAVGKLEQLSVFGNDYPTKDGTGVRDYIHVVDLAEGH 242 H SG IGEDP+GIPNNL+P++AQVA G+ LSV+G+DYPT DGTGVRDYIHVVDLA GH Sbjct: 186 HESGLIGEDPSGIPNNLLPFIAQVADGRRAALSVYGSDYPTPDGTGVRDYIHVVDLALGH 245 Query: 243 VKALEKVLNSTGADAYNLGTGTGYSVLEMVKAFEKVSGKEVPYRFADRRPGDIATCFADP 302 +K L K+ G YNLGTG G SVLEM+ AFE+ G ++PY+ DRRPGDIA C+A Sbjct: 246 LKTLRKLEQGPGVYTYNLGTGRGNSVLEMLAAFEQACGNKLPYQLVDRRPGDIACCYAAT 305 Query: 303 AKAKRELGWEAKRGLEEMCADSWRWQS 329 +A+RELGW A+RG+E MCAD+WRWQ+ Sbjct: 306 ERAERELGWRAQRGIEAMCADTWRWQA 332 Lambda K H 0.315 0.134 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 450 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 339 Length of database: 343 Length adjustment: 29 Effective length of query: 310 Effective length of database: 314 Effective search space: 97340 Effective search space used: 97340 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate HSERO_RS10045 HSERO_RS10045 (UDP-glucose 4-epimerase)
to HMM TIGR01179 (galE: UDP-glucose 4-epimerase GalE (EC 5.1.3.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01179.hmm # target sequence database: /tmp/gapView.20444.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01179 [M=332] Accession: TIGR01179 Description: galE: UDP-glucose 4-epimerase GalE Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.2e-142 457.8 0.0 9.6e-142 457.6 0.0 1.0 1 lcl|FitnessBrowser__HerbieS:HSERO_RS10045 HSERO_RS10045 UDP-glucose 4-epim Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__HerbieS:HSERO_RS10045 HSERO_RS10045 UDP-glucose 4-epimerase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 457.6 0.0 9.6e-142 9.6e-142 2 327 .. 6 333 .. 5 338 .. 0.99 Alignments for each domain: == domain 1 score: 457.6 bits; conditional E-value: 9.6e-142 TIGR01179 2 iLvtGgaGyiGshvvrqllekgkevvvlDnlskgskealkalekit..evklvegdladkekleavle 67 iLvtGgaGyiGsh++++l ++g+ vvvlDnl+++ ++++ ++ +i+ + ++v+gd++d++ l+ +++ lcl|FitnessBrowser__HerbieS:HSERO_RS10045 6 ILVTGGAGYIGSHTCVELIHAGYAVVVLDNLCNSRASVIDRIAQISgqRPHFVQGDIRDRAVLDGIFK 73 9********************************************99999****************** PP TIGR01179 68 eekidaviHfaaliavgEsvkePlkYYennvvntleLleamqkagvkkliFsssaavYgesekvpisE 135 +++i+aviHfa+l+avgEsv++Pl+YY+nnv+++ +L eam+++gvk+++Fsssa+vYg++ +vpi+E lcl|FitnessBrowser__HerbieS:HSERO_RS10045 74 SHRIEAVIHFAGLKAVGESVAQPLRYYDNNVHGSNVLFEAMAAHGVKNIVFSSSATVYGDPASVPITE 141 ******************************************************************** PP TIGR01179 136 esplnpinpYGrsklmvErilkdlkkadkelkvviLRYFnvaGAdeegeiGeasknat.hliklvaev 202 e+pl+++npYGrsklmvE+il dl+ ad+++++++LRYFn++GA+e+g iGe++++++ +l++ +a+v lcl|FitnessBrowser__HerbieS:HSERO_RS10045 142 EFPLSATNPYGRSKLMVEQILGDLHVADPSWRIALLRYFNPVGAHESGLIGEDPSGIPnNLLPFIAQV 209 **********************************************************9********* PP TIGR01179 203 avgkrekleifGtdyptkDGtcvRDyiHveDlaeaHlaalealeeggesevynlGagqgfsvkeviea 270 a g+r +l+++G dypt+DGt+vRDyiHv Dla +Hl++l++le+g ++ +ynlG+g+g+sv+e++ a lcl|FitnessBrowser__HerbieS:HSERO_RS10045 210 ADGRRAALSVYGSDYPTPDGTGVRDYIHVVDLALGHLKTLRKLEQGPGVYTYNLGTGRGNSVLEMLAA 277 ******************************************************************** PP TIGR01179 271 vkkvsgkdikveladrRaGDpaslvadaskikrelgwkpkyddLeeiiksawdWekk 327 +++++g++++++l drR+GD+a+++a +++++relgw+++++ +e +++++w+W+ lcl|FitnessBrowser__HerbieS:HSERO_RS10045 278 FEQACGNKLPYQLVDRRPGDIACCYAATERAERELGWRAQRG-IEAMCADTWRWQAL 333 ******************************************.***********975 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (332 nodes) Target sequences: 1 (343 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.23 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory