Align UDP-glucose 4-epimerase; Galactowaldenase; UDP-galactose 4-epimerase; EC 5.1.3.2 (characterized)
to candidate HSERO_RS21095 HSERO_RS21095 UDP-glucose 4-epimerase
Query= SwissProt::Q9ZDJ5 (341 letters) >FitnessBrowser__HerbieS:HSERO_RS21095 Length = 336 Score = 467 bits (1202), Expect = e-136 Identities = 229/338 (67%), Positives = 279/338 (82%), Gaps = 4/338 (1%) Query: 1 MFVDKTLMITGGTGSFGNAVLSRFLKSNIINDIKEIRIFSRDEKKQEDMRIALNNSKLKF 60 MF D LMITGGTGSFG VL+RFL + + +EIR+FSRDEKKQED+RIALNN KL+F Sbjct: 1 MFDDSVLMITGGTGSFGQTVLNRFLNTGV----REIRVFSRDEKKQEDLRIALNNEKLRF 56 Query: 61 YIGDVRNYQSIDDAMHGVDYVFHAAALKQVPTCEFYPMEAINTNVLGAENVLSAAINNKV 120 YIGDVR+ S+ AM GVDYVFHAAALKQVP+CEFYPMEA+ TNV+G ENVL + V Sbjct: 57 YIGDVRDPDSLRAAMKGVDYVFHAAALKQVPSCEFYPMEAVKTNVIGTENVLRVSSECGV 116 Query: 121 TKVIVLSTDKAVYPINAMGLSKALMEKLAIAKARMRSPGETILCVTRYGNVMASRGSVIP 180 +V+VLSTDKAVYPINAMG+SKA+ EK+ +A AR + GET+ C TRYGNVMASRGSVIP Sbjct: 117 RRVVVLSTDKAVYPINAMGISKAMAEKVMVAAARTQRQGETVFCATRYGNVMASRGSVIP 176 Query: 181 LFIHQIKQGKELTITEPSMTRFLMSLVDSVDLVLYAFEHGRQGDIFVQKSPASTIEVLAK 240 LF+ QIK K +TIT+P+MTRFLMSL DSVDLVLYAF+HG+QGDIFVQK+PAST+ LA Sbjct: 177 LFVSQIKAEKPITITDPNMTRFLMSLEDSVDLVLYAFQHGQQGDIFVQKAPASTVADLAS 236 Query: 241 ALQEIFGSKNAIRFIGTRHGEKHYESLVSSEDMAKADDLGGYYRIPMDGRDLNYAKYFVT 300 AL+E+F S ++ IGTRHGEK YESL+S E+MA A D+G YYRIP D RDLNYAKYF Sbjct: 237 ALKELFSSDTVVKTIGTRHGEKLYESLISREEMAHAQDMGDYYRIPADNRDLNYAKYFSE 296 Query: 301 GEKKVALLDDYTSHNTKRLNLKEVKELLLTLDYVQKEL 338 G++ ++L DDYTSHNT+RLN++++K+LLL LD++++EL Sbjct: 297 GDQDISLFDDYTSHNTRRLNVEQIKQLLLGLDFIKEEL 334 Lambda K H 0.319 0.135 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 394 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 336 Length adjustment: 28 Effective length of query: 313 Effective length of database: 308 Effective search space: 96404 Effective search space used: 96404 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory