Align GguB aka ATU2346 aka AGR_C_4262, component of Multiple sugar (arabinose, xylose, galactose, glucose, fucose) putative porter (characterized)
to candidate HSERO_RS05200 HSERO_RS05200 ABC transporter permease
Query= TCDB::O05177 (398 letters) >FitnessBrowser__HerbieS:HSERO_RS05200 Length = 405 Score = 516 bits (1329), Expect = e-151 Identities = 252/381 (66%), Positives = 315/381 (82%) Query: 17 GSYIRSNIREYGMLIALVAIMVFFQFYTGGILFRPVNLTNLILQNSFIVIMALGMLLVIV 76 GS++++N+REYGML++LVAIM FFQ T G L RP+NLTNL+LQNS+IVIMALGML+VIV Sbjct: 25 GSFLKNNMREYGMLMSLVAIMAFFQIMTDGTLMRPLNLTNLVLQNSYIVIMALGMLMVIV 84 Query: 77 AGHIDLSVGSIVAFVGAIAAILTVQWGMNPFLAALICLVIGGIIGAAQGYWIAYHRIPSF 136 AGHIDLSVGS+V +GA+AA+L V +G A+++CL+ GG+IGAAQGYWIAY +IPSF Sbjct: 85 AGHIDLSVGSVVGLIGALAAVLMVDYGWGFVPASIVCLIAGGLIGAAQGYWIAYFKIPSF 144 Query: 137 IVTLAGMLVFRGLTLFVLGGKNIGPFPTDFQVISTGFLPDIGGIEGLNTTSMILTVLITV 196 IVTLAGMLVF+G+ L +L G+++GPFP FQ++S+GF+P++ G TTS+I+ V+ V Sbjct: 145 IVTLAGMLVFKGMALALLQGQSLGPFPQTFQMLSSGFIPELTGNTTFRTTSLIVGVIAAV 204 Query: 197 ALFYLAWRRRVVNVKHGIDVEPFGFFIVQNLLISGAILFLGYQLSTYRGLPNVLIVMLVL 256 L + R KHG++ EP FF+++N + + AI+ Y LSTYRG+PNVLI+M L Sbjct: 205 VLILVKLHGRRKQTKHGMEDEPVLFFLLKNGVFAAAIIAFSYLLSTYRGMPNVLIIMFAL 264 Query: 257 IALYSFVTRRTTIGRRVYAMGGNEKATKLSGINTERLSFLTFVNMGVLAGLAGMIIATRL 316 + LY+F+T RTT+GRRVYA+GGNEKA KLSGI TER+SF TFVNMGVLA LAG+I A RL Sbjct: 265 MVLYTFITSRTTLGRRVYAVGGNEKAAKLSGIKTERVSFFTFVNMGVLAALAGLIFAARL 324 Query: 317 NSATPKAGVGFELDVIAACFIGGASASGGVGKITGAVIGAFIMGVMNNGMSIVGLGIDFQ 376 N+ATPKAG+GFELDVIAACFIGGASASGGVGK+ GAVIGAF+MGVMNNGMSI+G+GID+Q Sbjct: 325 NTATPKAGLGFELDVIAACFIGGASASGGVGKVMGAVIGAFVMGVMNNGMSIMGIGIDYQ 384 Query: 377 QMVKGLVLLAAVFFDVYNKNK 397 QM+KG VLL AV FDVYNKNK Sbjct: 385 QMIKGFVLLMAVCFDVYNKNK 405 Lambda K H 0.329 0.145 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 660 Number of extensions: 24 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 398 Length of database: 405 Length adjustment: 31 Effective length of query: 367 Effective length of database: 374 Effective search space: 137258 Effective search space used: 137258 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory