Align Galactose/methyl galactoside import ATP-binding protein MglA; EC 7.5.2.11 (characterized)
to candidate HSERO_RS03640 HSERO_RS03640 D-ribose transporter ATP-binding protein
Query= SwissProt::P23924 (506 letters) >FitnessBrowser__HerbieS:HSERO_RS03640 Length = 502 Score = 382 bits (980), Expect = e-110 Identities = 197/494 (39%), Positives = 306/494 (61%), Gaps = 4/494 (0%) Query: 13 LLEMRGINKSFPGVKALDNVNLNVRPHSIHALMGENGAGKSTLLKCLFGIYQKDSGSIVF 72 LL+MRGI KSF AL +++L +RP IHALMGENGAGKSTL+K L G++ D G I+ Sbjct: 10 LLQMRGIRKSFGATLALSDMHLTIRPGEIHALMGENGAGKSTLMKVLSGVHAPDQGEILL 69 Query: 73 QGKEVDFHSAKEALENGISMVHQELNLVLQRSVMDNMWLG-RYPTKGMFVDQDKMYQDTK 131 G+ V + GI++++QEL + SV N+++G T+ +D M T Sbjct: 70 DGRPVALRDPGASRAAGINLIYQELAVAPNISVAANVFMGSELRTRLGLIDHAAMRSRTD 129 Query: 132 AIFDELDIDIDPRARVGTLSVSQMQMIEIAKAFSYNAKIVIMDEPTSSLTEKEVNHLFTI 191 A+ +L G LS+++ Q +EIA+A + ++IVIMDEPT++L+E+E LF + Sbjct: 130 AVLRQLGAGFGASDLAGRLSIAEQQQVEIARALVHRSRIVIMDEPTAALSERETEQLFNV 189 Query: 192 IRKLKERGCGIVYISHKMEEIFQLCDEITILRDGQWIATQPLEGLDMDKIIAMMVGRSLN 251 +R+L++ G I+YISH+M E++ L D +T+LRDG ++ + +D ++I+ MMVGRSL+ Sbjct: 190 VRRLRDEGLAIIYISHRMAEVYALADRVTVLRDGSFVGELVRDEIDSERIVQMMVGRSLS 249 Query: 252 QRFPDKENKPGDV--ILEVRHLTSLRQPSIRDVSFDLHKGEILGIAGLVGAKRTDIVETL 309 + + + P D + V + +L IR SFD+ GE+LG AGLVGA RT++ L Sbjct: 250 EFYQHQRIAPADAAQLPTVMQVRALAGGKIRPASFDVRAGEVLGFAGLVGAGRTELARLL 309 Query: 310 FGIREKSSGTITLHGKKINNHTANEAINHGFALVTEERRSTGIYAYLDIGFNSLISNIRN 369 FG +S G I L G+ ++ A+ G A V E+R+ G++ + + N+ + N+ + Sbjct: 310 FGADPRSGGDILLEGRPVHIDQPRAAMRAGIAYVPEDRKGQGLFLQMAVAANATM-NVAS 368 Query: 370 YKNKVGLLDNSRMKSDTQWVIDSMRVKTPGHRTQIGSLSGGNQQKVIIGRWLLTQPEILM 429 ++GL+ + + + I + VK T +G LSGGNQQKV++ RWL P++L+ Sbjct: 369 RHTRLGLVRSRSLGGVARAAIQRLNVKVAHPETPVGKLSGGNQQKVLLARWLEIAPKVLI 428 Query: 430 LDEPTRGIDVGAKFEIYQLIAELAKKGKGIIIISSEMPELLGITDRILVMSNGLVSGIVD 489 LDEPTRG+D+ AK EIYQL+ LA +G +++ISSE+PE++GI DR+LVM G+++G + Sbjct: 429 LDEPTRGVDIYAKSEIYQLVHRLASQGVAVVVISSELPEVIGICDRVLVMREGMITGELA 488 Query: 490 TKTTTQNEILRLAS 503 TQ I+RLA+ Sbjct: 489 GAAITQENIMRLAT 502 Lambda K H 0.319 0.137 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 554 Number of extensions: 32 Number of successful extensions: 9 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 506 Length of database: 502 Length adjustment: 34 Effective length of query: 472 Effective length of database: 468 Effective search space: 220896 Effective search space used: 220896 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory