Align Galactofuranose transporter permease protein YtfT (characterized)
to candidate HSERO_RS05180 HSERO_RS05180 sugar ABC transporter permease
Query= SwissProt::P39328 (341 letters) >FitnessBrowser__HerbieS:HSERO_RS05180 Length = 359 Score = 295 bits (756), Expect = 9e-85 Identities = 164/326 (50%), Positives = 227/326 (69%), Gaps = 13/326 (3%) Query: 25 LVALLLVLLVDSLVAPHFWQVVLQDGRLFGSPIDILNRAAPVALLAIGMTLVIATGGIDL 84 L AL ++LL+D L+ P F+++ ++DG L+G+ IDI+NRAAP+ L A+GMTLVIAT G+D+ Sbjct: 34 LGALAVLLLIDFLLVPGFFKLEIKDGHLYGALIDIINRAAPLMLAALGMTLVIATRGVDI 93 Query: 85 SVGAVMAIAGATTAAM------TVAGFS-----LPIV--LLSALGTGILAGLWNGILVAI 131 SVGAV+AI+GA A + V G S +P+V L +A+G +L G WNG+LVA Sbjct: 94 SVGAVVAISGAVAAILIGGKMVVVDGVSQYVSNVPMVWALCAAMGAALLCGAWNGLLVAG 153 Query: 132 LKIQPFVATLILMVAGRGVAQLITAGQIVTFNSPDLSWFGSGSLLFLPTPVIIAVLTLIL 191 L +QP +ATLILMVAGRG+AQL+T GQIVT + G G L LP + IA +L Sbjct: 154 LGLQPIIATLILMVAGRGLAQLLTDGQIVTVYYKPFFFLGGGYLFGLPFSLYIAAAMFVL 213 Query: 192 FWLLTRKTALGMFIEAVGINIRAAKNAGVNTRIIVMLTYVLSGLCAAIAGIIVAADIRGA 251 LL +KTALG+FIE+VGIN A++ AG+ T ++ Y+ CA +AG+++A++I+ A Sbjct: 214 LALLMKKTALGLFIESVGINPVASRLAGIRTAALIFFVYMFCSACAGLAGLMIASNIKSA 273 Query: 252 DANNAGLWLELDAILAVVIGGGSLMGGRFNLLLSVVGALIIQGMNTGILLSGFPPEMNQV 311 DANNAGL LELDAILAV +GG SL GG+F+L+ SV+GALIIQ + I G PPE+N V Sbjct: 274 DANNAGLLLELDAILAVTLGGTSLAGGKFSLVGSVIGALIIQTLTYTIYSLGVPPEVNMV 333 Query: 312 VKAVVVLCVLIVQSQRFISLIKGVRS 337 VK++VV V + QS +F +++ +S Sbjct: 334 VKSIVVFLVCLSQSPQFRRMLRMSKS 359 Lambda K H 0.327 0.142 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 338 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 359 Length adjustment: 29 Effective length of query: 312 Effective length of database: 330 Effective search space: 102960 Effective search space used: 102960 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory