Align Galactofuranose transporter permease protein YtfT (characterized)
to candidate HSERO_RS05325 HSERO_RS05325 ribose ABC transporter permease
Query= SwissProt::P39328 (341 letters) >FitnessBrowser__HerbieS:HSERO_RS05325 Length = 328 Score = 185 bits (469), Expect = 2e-51 Identities = 107/306 (34%), Positives = 176/306 (57%), Gaps = 11/306 (3%) Query: 19 PTGMPQLVALLLVLLVDSLVAPHFWQVVLQDGRLFGSPIDILNRAAPVALLAIGMTLVIA 78 P +P L L++V L+ L + +F+ + + ++L + + V +LA+GM+ VI Sbjct: 28 PLALP-LAGLVVVSLLMGLASDNFFTL--------SNWFNVLRQVSIVGILAVGMSFVIL 78 Query: 79 TGGIDLSVGAVMAIAGATTAAMTV-AGFSLPIVLLSALGTGILAGLWNGILVAILKIQPF 137 TGGIDLSVGA MA+AG +A + V +G P+ LL +G GL NG LVA ++ Sbjct: 79 TGGIDLSVGAAMALAGTISAGLIVNSGLPAPLALLCGVGLATCIGLLNGALVAWGRMPAI 138 Query: 138 VATLILMVAGRGVAQLITAGQIVTFNSPDLSWFGSGSLLFLPTPVIIAVLTLILFWLLTR 197 + TL M RGV + + G ++ +SWFG G + +P PVI+ ++ L WLL + Sbjct: 139 IVTLATMGVARGVGLIYSGGYPISGLPGWISWFGVGRIGMVPVPVILMLIVYALAWLLLQ 198 Query: 198 KTALGMFIEAVGINIRAAKNAGVNTRIIVMLTYVLSGLCAAIAGIIVAADIRGADANNAG 257 +TA G + A+G N AA+ +GV T I + Y +SG + +A II+ + NAG Sbjct: 199 RTAFGRHVYAIGGNEMAARLSGVKTTRIKLAVYAISGFTSGLAAIILTGRLMSGQP-NAG 257 Query: 258 LWLELDAILAVVIGGGSLMGGRFNLLLSVVGALIIQGMNTGILLSGFPPEMNQVVKAVVV 317 + ELDAI AVV+GG ++ GGR ++ +++GA+++ +N G+ L G P + +++ V++ Sbjct: 258 VGFELDAIAAVVLGGTAIAGGRGLVVGTLIGAVLLGILNNGLNLMGINPYLQDIIRGVII 317 Query: 318 LCVLIV 323 L + + Sbjct: 318 LLAIYI 323 Lambda K H 0.327 0.142 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 332 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 328 Length adjustment: 28 Effective length of query: 313 Effective length of database: 300 Effective search space: 93900 Effective search space used: 93900 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory