Align 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; EC 2.7.1.45 (characterized)
to candidate HSERO_RS07545 HSERO_RS07545 2-dehydro-3-deoxygluconokinase
Query= SwissProt::P50845 (324 letters) >FitnessBrowser__HerbieS:HSERO_RS07545 Length = 313 Score = 324 bits (830), Expect = 2e-93 Identities = 168/308 (54%), Positives = 209/308 (67%), Gaps = 2/308 (0%) Query: 1 MKLDAVTFGESMAMFYANEYGGLHEVSTFSKGLAGAESNVACGLARLGFRMGWMSKVGND 60 M+LD VT+GE++A+ A+E G EV +++ LAGAE+NVA GLARLG ++GW S+VGND Sbjct: 3 MQLDVVTWGEALALLVADEVGPFEEVEKYTRRLAGAETNVAIGLARLGLKVGWASRVGND 62 Query: 61 QLGTFILQELKKEGVDVSRVIRSQDENPTGLLLKSKVKEG-DPQVTYYRKNSAASTLTTA 119 G FI Q + +EGV+VSRVI E T + LK+K G DP + YYRK SAAS L+ Sbjct: 63 AFGRFIRQRVAQEGVEVSRVITDM-EFRTAIQLKAKAVGGADPAIEYYRKGSAASHLSVD 121 Query: 120 EYPRDYFQCAGHLHVTGIPPALSAEMKDFTYHVMNDMRNAGKTISFDPNVRPSLWPDQAT 179 ++ YF A HLH TGI PALSA F + M+ MR GKTISFDPN+RP LWP Q Sbjct: 122 DFDAGYFGAARHLHATGIAPALSATTMAFAHQAMDFMRGQGKTISFDPNLRPMLWPSQEV 181 Query: 180 MVHTINDLAGLADWFFPGIAEGELLTGEKTPEGIADYYLKKGASFVAIKLGKEGAYFKTG 239 M +N LA ADW PG++EG++LTG IA +YL++G V IKLG EGAY++ G Sbjct: 182 MAQQLNALAFKADWVLPGLSEGKILTGHDDAREIAGFYLERGVKLVVIKLGAEGAYWRNG 241 Query: 240 TSEGFLEGCRVDRVVDTVGAGDGFAVGVISGILDGLSYKDAVQRGNAIGALQVQAPGDMD 299 EG + G V VVDTVGAGDGFAVGVISG+L+GL AV RGN IGA +Q GDM+ Sbjct: 242 QGEGRVAGVPVKEVVDTVGAGDGFAVGVISGMLEGLPVPQAVMRGNRIGAFAIQVVGDME 301 Query: 300 GLPTREKL 307 GLPTR +L Sbjct: 302 GLPTRAEL 309 Lambda K H 0.317 0.135 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 328 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 313 Length adjustment: 27 Effective length of query: 297 Effective length of database: 286 Effective search space: 84942 Effective search space used: 84942 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory