Align ABC transporter substrate-binding protein (characterized, see rationale)
to candidate HSERO_RS04240 HSERO_RS04240 C4-dicarboxylate ABC transporter
Query= uniprot:A0A165IVH1 (339 letters) >FitnessBrowser__HerbieS:HSERO_RS04240 Length = 334 Score = 183 bits (465), Expect = 5e-51 Identities = 116/335 (34%), Positives = 189/335 (56%), Gaps = 10/335 (2%) Query: 6 RTLLAALSVAAITCSFQAAAQDFKPRIIRFGYGLNEVSNQGRATKLFAEEVEKASGGKMK 65 +++L A++ AAI S A AQ +P +I+F + + + +G+A + F E EKA+ G++K Sbjct: 4 KSILLAMTAAAIV-STNAFAQ--QPIVIKFSHVVANDTPKGKAAERFKELAEKATKGRVK 60 Query: 66 VRAIGAAALGSDVQMQQALIGGAQEMMVGSTATLVGI-TKEMAIWDTPFLFNNAKEADVV 124 + + L D + +AL GA +M+ S A + KE ++D P++F + V Sbjct: 61 IEVYPNSTLYKDKEELEALQLGAVQMLAPSLAKFGPLGVKEFEVFDLPYIFPTKEVLYRV 120 Query: 125 LDGPVGQKVMDKLQEKGLVGLVYWENGFRNLTNSKRPVNKLEDMDGIKLRVMQNNVFLDS 184 +GP+G+ + KL+ KG+ GL YW+NGF+ ++ +K P++ D G+K+R+ + V Sbjct: 121 TEGPIGKDLFKKLEPKGITGLAYWDNGFKVMSANK-PLHHPADFRGLKMRIQSSKVLDAQ 179 Query: 185 FKTLGANAVPLPFSELFTALETKTVDGQENPYNTILSSKFYEVQKYLTVTNHVYSPWIVL 244 + LGAN L FSE++ AL+T VDG ENP + + + K +EVQK++TV+NH Y + V+ Sbjct: 180 MRALGANPQVLAFSEVYQALQTGVVDGTENPPSNLYTQKMHEVQKHVTVSNHGYLGYAVI 239 Query: 245 VSKKYWDGLSKAEQKVLLDAAKKSRDFERQDTRAEADKALADLKGKG-MQVNELPAAEAN 303 V+KK+WDGL + L A K + + + E D ALA ++ G V L AE Sbjct: 240 VNKKFWDGLPSDIRTQLEGAMKDATKYANAIAQQENDAALAAVEKTGKTTVYRLTDAEKA 299 Query: 304 RMREKLSAVNASIAANVGESLWKDVQGAVAQARAA 338 R+ L V +A+ +G KD+ AV + AA Sbjct: 300 EWRKALLPVQQQMASRIG----KDLIDAVNKESAA 330 Lambda K H 0.316 0.130 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 266 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 339 Length of database: 334 Length adjustment: 28 Effective length of query: 311 Effective length of database: 306 Effective search space: 95166 Effective search space used: 95166 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory