Align TRAP dicarboxylate transport system, periplasmic component (DctP-like) (characterized, see rationale)
to candidate HSERO_RS14035 HSERO_RS14035 C4-dicarboxylate ABC transporter
Query= uniprot:G8AR24 (337 letters) >FitnessBrowser__HerbieS:HSERO_RS14035 Length = 344 Score = 176 bits (447), Expect = 6e-49 Identities = 105/331 (31%), Positives = 180/331 (54%), Gaps = 9/331 (2%) Query: 9 LATGLAAAILA------PVAASAQDIKPRLIRFGYGLSESSNQGRAVKFFVEDMAKRSGG 62 L T LAA P A + Q +P +I+F + ++ + +G+ + F E K + G Sbjct: 6 LRTALAACAFVTLGLPQPAALAQQPQQPIIIKFSHVVANDTPKGKGAERFKELAEKATQG 65 Query: 63 KLKVKGFADASLGSDIQMQNALIGGAQEMMVGSTATLVGI-VKDFAVFDLPFLFNNEQEA 121 ++KV+ + +++L D + AL G+ +M+ S A + ++F VFDLP++F ++ Sbjct: 66 RVKVEVYPNSTLYKDKEELEALQLGSVQMLAPSLAKFGPLGAREFEVFDLPYIFPDKAVL 125 Query: 122 DAVFDGPFGQKLAAKLNDKGLVGLVYWENGFRNLTNSKRPVEKVEDLKGIKLRVMQNPVY 181 V +GP GQ L KL KG+ GL YW+NG + +T + RP+ KV D + +K+R+ + V Sbjct: 126 KRVTEGPIGQGLFQKLEGKGIKGLAYWDNGMKVMT-ANRPLHKVADFRALKMRIQSSKVL 184 Query: 182 IDMFNGFGANAVPLSFSELFTAMETGTVDGQENPVTTIQSSKFYEVQKYLTISKHVYSPW 241 + F AN L+FSE++ AM+TG VDG EN + + + K +EVQ LT+S H Y + Sbjct: 185 DEQFRALKANPQVLAFSEVYQAMQTGVVDGSENTPSNVYTQKMHEVQSNLTVSDHGYIGY 244 Query: 242 IVLASKRWYDGLSADERKIINEAAVASRDFERKDSREASKQSIAYLKDKG-MQINELSDA 300 V+ +K++++ L AD R + A + + +++ + ++A +K G ++ LS+ Sbjct: 245 AVIVNKKFWEALPADIRSQLEAAMKQATLYANTIAQKENDDALAAIKASGKTRVYTLSEQ 304 Query: 301 ELGRMREMVKPAMDKFAADGGADLLNELQGE 331 E R + P AA GADL+ + E Sbjct: 305 EKAEWRRALLPVHKSMAARVGADLIEAIYKE 335 Lambda K H 0.317 0.134 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 228 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 337 Length of database: 344 Length adjustment: 28 Effective length of query: 309 Effective length of database: 316 Effective search space: 97644 Effective search space used: 97644 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory