Align ABC transporter for D-glucosamine, permease component 1 (characterized)
to candidate HSERO_RS17545 HSERO_RS17545 glutamine ABC transporter permease
Query= reanno::pseudo3_N2E3:AO353_21715 (220 letters) >FitnessBrowser__HerbieS:HSERO_RS17545 Length = 218 Score = 151 bits (382), Expect = 8e-42 Identities = 79/214 (36%), Positives = 126/214 (58%), Gaps = 1/214 (0%) Query: 6 NFAAVWRDFDTLLAGLGLGLELALVSIAIGCVIGLLMAFALLSKHRALRVLASVYVTVIR 65 +F+ + LL G + + + + G ++GLL + L+ + YV +R Sbjct: 4 DFSVITDSLPALLEGAKVTVLITAAGLVGGTLVGLLAGLMRAYGNTLLKGIGFGYVEFVR 63 Query: 66 NTPILVLILLIYFALPSL-GIRLDKLPSFIITLSLYAGAYLTEVFRGGLLSIPKGLREAG 124 TPI+V ++ IYFALP L GIR+D + + + ++ + +GAY+ E+ RG LS+P+GLREAG Sbjct: 64 GTPIVVQVMFIYFALPVLLGIRVDPMTAAVTSIVVNSGAYIAEIVRGAFLSVPRGLREAG 123 Query: 125 LAIGLGEWQVKAYVTVPVMLRNVLPALSNNFISLFKDTSLAAAIAVPELTYYARKINVES 184 LA+GL W+V A+V PV +R ++PA+ N FI KDTSL I V ELT ++I + Sbjct: 124 LALGLPVWRVLAFVIGPVAIRRMVPAMGNQFIVSLKDTSLFIVIGVGELTRQGQEIMAAN 183 Query: 185 YRVIETWLVTTALYVAACYLIAMLLRYLEQRLAI 218 +R +E W+ A+Y+ ++ LR E+R+ I Sbjct: 184 FRAVEIWIAVAAIYLCMIGVMTYALRTFEKRMRI 217 Lambda K H 0.329 0.143 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 170 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 220 Length of database: 218 Length adjustment: 22 Effective length of query: 198 Effective length of database: 196 Effective search space: 38808 Effective search space used: 38808 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory