Align Glucosamine kinase GspK; GlcN kinase; EC 2.7.1.8 (characterized)
to candidate HSERO_RS22755 HSERO_RS22755 ATPase
Query= SwissProt::Q9KUA9 (294 letters) >FitnessBrowser__HerbieS:HSERO_RS22755 Length = 308 Score = 131 bits (330), Expect = 2e-35 Identities = 92/294 (31%), Positives = 138/294 (46%), Gaps = 16/294 (5%) Query: 3 YYVGIDGGGTSCRARIRNQQGEWVGEAKSGSANIMLGVEVALRSVVDAITQAAEQGGLSP 62 Y VG+DGGGT R+ + G+ +G+A + + G A R + I + GL Sbjct: 6 YLVGVDGGGTKTLVRLASLHGKTLGQASGPGSALRNGAAHAWRVIGRTIEASFAAAGLKR 65 Query: 63 DDFPSMHVGLALAGAEQKEAWHA-FMQQAHPFASITLNTDAYGACLGAHLGEEGAIMIAG 121 ++ VG+ +AG E W A F A F ++ + D LGAH G GAI+ G Sbjct: 66 PADQALAVGIGIAG-ENVAQWSADFRTMAPAFGALDIVNDGVATLLGAHGGAPGAIVAVG 124 Query: 122 TGSCGILLK-GGKQYVVGGREFPISDQGSGAVMGLRLIQQVLLAQDGIRPHTPLCDVVMN 180 TG+ G+ L G + VV G FP D GSG MGLR + LA DG P PL D V+ Sbjct: 125 TGTIGLALDIDGSRRVVDGWGFPSGDDGSGGWMGLRALHHAQLALDGRSPRGPLADAVLA 184 Query: 181 HFNHDID------------SIVAWSKTALPRDYGQFSPQIFSHAYCGDPLAIELLKQTAA 228 ++ +++ W A + + + + + A D A +L+ AA Sbjct: 185 LCRAELPAHPGQPARDERATLLDWLSQADQAAFARAARPVVAQA-ANDEAARAILQAAAA 243 Query: 229 DIEMFLIALHHKGAERICLMGSIAERIQDWLSPPVQQWIVKPQSDAIEGALMFA 282 +I + + L + L G +A +Q +L P Q IV PQ+DA++GAL+ A Sbjct: 244 EISLMIATLDPAQRLPLALCGGLAAALQAYLDPRQQARIVAPQADAVDGALLLA 297 Lambda K H 0.320 0.137 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 288 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 294 Length of database: 308 Length adjustment: 27 Effective length of query: 267 Effective length of database: 281 Effective search space: 75027 Effective search space used: 75027 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory