Align Glucosamine-6-phosphate deaminase [isomerizing], alternative (EC 3.5.99.6) (characterized)
to candidate HSERO_RS22125 HSERO_RS22125 glucosamine--fructose-6-phosphate aminotransferase
Query= reanno::Korea:Ga0059261_1644 (347 letters) >FitnessBrowser__HerbieS:HSERO_RS22125 Length = 605 Score = 133 bits (334), Expect = 1e-35 Identities = 104/312 (33%), Positives = 157/312 (50%), Gaps = 22/312 (7%) Query: 51 VVTCARGSSDHAATYAKYLIETLTGVPTASAALSVASLYDAPVAPGNGLCLAISQSGKSP 110 ++ A G+S +A AKY +E++ +P S D+ P L + ISQSG++ Sbjct: 291 ILILACGTSYYAGLTAKYWLESIAKIPVNVEIASEYRYRDSVPNP-KSLVVTISQSGETA 349 Query: 111 DLLATVEHQRKAGA-FVVAMVNAEDSPLAALADIVIPLKAGPERSVAATKSYICSLAAIA 169 D LA ++H R G + + N S + ++ +AG E VA+TK++ LAA+ Sbjct: 350 DTLAALKHARSLGMQHTLTICNVATSAMVRECELAYITRAGVEVGVASTKAFTTQLAALF 409 Query: 170 ALVAAWAQDEALET---------AVADLPAQLERAFALDWSAAVTALTGA---SGLFVLG 217 L A AQ L T A+ LPA L+ AL+ S A + A + LF LG Sbjct: 410 LLTLALAQTRGLLTEEQEAEHLKAMRHLPAALQSVLALEPSIVAWAESFARRENALF-LG 468 Query: 218 RGYGYGIAQEAALKFKETCALHAESFSAAEVRHGPMAIVGEAFHVLAFASSDRAGESVRE 277 RG Y IA E ALK KE +HAE+++A E++HGP+A+V + V+ A +D E ++ Sbjct: 469 RGLHYPIALEGALKLKEITYIHAEAYAAGELKHGPLALVTDQMPVVTIAPNDALVEKLKS 528 Query: 278 TVAEFRSRGAEV-LLAD---PAARQAGLPAIAA---HPAIEPILIVQSFYKMANALALAR 330 + E R+RG ++ + AD + GL I + + PIL V ++ ALAR Sbjct: 529 NMQEVRARGGQLYVFADGDSHISSAEGLHVIRMPEHYGVLSPILHVVPLQLLSYHTALAR 588 Query: 331 GCDPDSPPHLNK 342 G D D P +L K Sbjct: 589 GTDVDKPRNLAK 600 Lambda K H 0.317 0.128 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 384 Number of extensions: 23 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 347 Length of database: 605 Length adjustment: 33 Effective length of query: 314 Effective length of database: 572 Effective search space: 179608 Effective search space used: 179608 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory