Align Glucose kinase (characterized, see rationale)
to candidate HSERO_RS17870 HSERO_RS17870 glucokinase
Query= uniprot:Q8P6M4 (344 letters) >FitnessBrowser__HerbieS:HSERO_RS17870 Length = 333 Score = 152 bits (385), Expect = 9e-42 Identities = 102/302 (33%), Positives = 149/302 (49%), Gaps = 10/302 (3%) Query: 23 LAADVGGTHVRVGRVSHGADAPIELSQYRTYRCADHASL-DAILADF-LRDSRAVDAVVI 80 L AD+GGT+ R + P + Q + R AD+ DA+ A L V V+ Sbjct: 18 LLADIGGTNARFALET----GPGRIEQVQILRGADYGEFTDAVQAYLKLAGHPPVRHAVV 73 Query: 81 ASAGVALDDGRFISNNLPWTIAPRQLRDTLGVRAVHLVNDFEAVAYAAPQMEQRAVVQLS 140 A A D ++N+ W + R LG + +VNDF A++ A PQ+ + Q+ Sbjct: 74 AIANPVQGDQIKMTNH-DWAFSIEAARQLLGFELLLVVNDFTALSMAVPQLRADELQQVG 132 Query: 141 GPTPRHAQPGGPILVVGPGTGLGAAVWINGPRQPTVLATEAGQVALASNDPDTAQVLRIL 200 G P+ PG PI +VG GTGLG ++ LA+E G A A DP A VL Sbjct: 133 GGAPK---PGAPIGLVGAGTGLGVGGLLHADGHWLPLASEGGHAAFAPADPREAAVLAYA 189 Query: 201 ARDASYLPIEHVLSGPGLRNLYLALCELHAATPIHPLPADITHAALHSDDALARRCLQLF 260 + ++ E ++SGPGL ++ AL + A I A DAL + L LF Sbjct: 190 WQFHEHVSAERLVSGPGLELIHRALLAIDGHPAAELSAAQIVEGARQHGDALCQETLALF 249 Query: 261 CALLGSAVGDMALAYGASGGVYLAGGILPSIGQFLAASDFRERFLAKGRMRPVLERIPVK 320 C++LG+ D+AL GA GG+Y+ G++P +G + A S FR RF KGRM + + IP Sbjct: 250 CSMLGTVAADLALTLGALGGIYIGVGVVPHLGDYFARSPFRARFENKGRMSVLTKAIPTY 309 Query: 321 LV 322 ++ Sbjct: 310 VI 311 Lambda K H 0.321 0.136 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 357 Number of extensions: 23 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 344 Length of database: 333 Length adjustment: 28 Effective length of query: 316 Effective length of database: 305 Effective search space: 96380 Effective search space used: 96380 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory