Align N-acetylglucosamine kinase (EC 2.7.1.59) (characterized)
to candidate HSERO_RS22755 HSERO_RS22755 ATPase
Query= reanno::ANA3:7025966 (302 letters) >FitnessBrowser__HerbieS:HSERO_RS22755 Length = 308 Score = 130 bits (326), Expect = 5e-35 Identities = 96/293 (32%), Positives = 138/293 (47%), Gaps = 13/293 (4%) Query: 13 IGVDGGGSKCRATIYTADGTVLGTGVAGRANPLHGLAQTFASIEASTRQALLDAGMKETD 72 +GVDGGG+K + + G LG + +G A + I + + AG+K Sbjct: 8 VGVDGGGTKTLVRLASLHGKTLGQASGPGSALRNGAAHAWRVIGRTIEASFAAAGLKRPA 67 Query: 73 SHLLVAGLGLAGVNVPRLYQDVISWQHPFAAMYVTTDLHTACIGAHRGADGAVIITGTGS 132 L G+G+AG NV + D + F A+ + D +GAH GA GA++ GTG+ Sbjct: 68 DQALAVGIGIAGENVAQWSADFRTMAPAFGALDIVNDGVATLLGAHGGAPGAIVAVGTGT 127 Query: 133 CGYAHVGDDSLS-IGGHGFALGDKGSGAWLGLKAAEHVLLALDGFATPTALTEMLL---- 187 G A D S + G GF GD GSG W+GL+A H LALDG + L + +L Sbjct: 128 IGLALDIDGSRRVVDGWGFPSGDDGSGGWMGLRALHHAQLALDGRSPRGPLADAVLALCR 187 Query: 188 ----KHFGV---SDALGIVEHLAGKSSSCYAELARSVLDCANAGDEVARGIVQEGADYIS 240 H G + +++ L+ + +A AR V+ A A DE AR I+Q A IS Sbjct: 188 AELPAHPGQPARDERATLLDWLSQADQAAFARAARPVVAQA-ANDEAARAILQAAAAEIS 246 Query: 241 EMARKLFSLNPVRFSMIGGLAEPLQAWLGSDVVAKISETLAPPELGAMYFAQQ 293 M L + ++ GGLA LQA+L A+I A GA+ AQ+ Sbjct: 247 LMIATLDPAQRLPLALCGGLAAALQAYLDPRQQARIVAPQADAVDGALLLAQR 299 Lambda K H 0.319 0.135 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 271 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 302 Length of database: 308 Length adjustment: 27 Effective length of query: 275 Effective length of database: 281 Effective search space: 77275 Effective search space used: 77275 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory