Align NgcG, component of N-Acetylglucosamine/N,N'-diacetyl chitobiose porter (NgcK (C) not identified) (characterized)
to candidate HSERO_RS01335 HSERO_RS01335 sugar ABC transporter permease
Query= TCDB::Q8RJU8 (307 letters) >FitnessBrowser__HerbieS:HSERO_RS01335 Length = 283 Score = 145 bits (367), Expect = 8e-40 Identities = 91/286 (31%), Positives = 152/286 (53%), Gaps = 9/286 (3%) Query: 25 PAPPQKEKKEGTVLNVFSHGI-LVLWAFMVVLPLLWAVMTSFK-DDASIFGSPWSLP-DK 81 P P +K K L S + L++W +LP+L A++TS + +D + G+ W P D Sbjct: 3 PMPIEKWKPINRALYRASLPVALLIW----LLPMLAALVTSIRSNDELMAGNYWGWPQDF 58 Query: 82 LHFDNWSRAWTEAHMGDYFLNTVLVVGGSLIGTLVLGSMAAYVLARFDFPGNRFIYYLFI 141 +N+ A T + M YF N+ L+ S+IG + L +MA + L+ + F GN ++ F+ Sbjct: 59 AMLENYREALTASPMLHYFWNSCLITIPSVIGAISLAAMAGFALSTYQFRGNTVLFATFV 118 Query: 142 GGMSFPIMLALVPLFYVVNNMGLLNTLHGLILVYIAYSLPFTVFFLTAFFRTLPSSVAEA 201 P + ++P+ + ++GL NT+ G++L +IA F FL F + LP + EA Sbjct: 119 ACNFVPQQILMIPVRDLSLSLGLFNTITGMMLFHIAMQTGFCTLFLRNFIKQLPFEMIEA 178 Query: 202 AFVDGASHTRTFFQIMLPMAKPGLISVGIFNFLGQWNQYMLPTVLNTDPDKRVLTQGLVQ 261 A ++GAS F++I+LP+ +P L ++ + F WN Y VL D +T G+ Sbjct: 179 ARIEGASEWTVFYRIVLPLIRPALAALAVLVFTFVWNDYFWALVLTQGDDVAPITVGVA- 237 Query: 262 LAVSQGYKGDWSGLFAGLVMAMLPVLAAYIIFQRQVVQGLTAGALK 307 A+ + W+ + AG ++A LP + + + Q+Q V GLT GA K Sbjct: 238 -ALRGQWTTAWNLVSAGSILAALPSVILFFVMQKQFVAGLTFGASK 282 Lambda K H 0.326 0.141 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 263 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 283 Length adjustment: 26 Effective length of query: 281 Effective length of database: 257 Effective search space: 72217 Effective search space used: 72217 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory