Align NgcG, component of N-Acetylglucosamine/N,N'-diacetyl chitobiose porter (NgcK (C) not identified) (characterized)
to candidate HSERO_RS22745 HSERO_RS22745 sugar ABC transporter permease
Query= TCDB::Q8RJU8 (307 letters) >FitnessBrowser__HerbieS:HSERO_RS22745 Length = 300 Score = 171 bits (432), Expect = 3e-47 Identities = 96/294 (32%), Positives = 156/294 (53%), Gaps = 4/294 (1%) Query: 16 TTVTKTDAPPAPPQKEKKEGTVLNVFSHGILVLWAFMVVLPLLWAVMTSFKDDASIFGSP 75 T+ T P ++ G +++ H +L L+A + + P+ ++ S K +IF P Sbjct: 9 TSSTSATIMRKPTLIQRSFGQAGHLWVHTVLCLYAVIALFPIALILINSVKTRNAIFEGP 68 Query: 76 WSLP--DKLHFDNWSRAWTEAHMGDYFLNTVLVVGGSLIGTLVLGSMAAYVLARFDFPGN 133 +LP + L F + + H YF N++ V +L ++ G+MAA+ L + F GN Sbjct: 69 MALPTAETLTFAGFQKVLAGTHFLLYFGNSLAVTVAALFLIVLFGAMAAWALTEYRFFGN 128 Query: 134 RFIYYLFIGGMSFPIMLALVPLFYVVNNMGLLNTLHGLILVYIAYSLPFTVFFLTAFFRT 193 R + + G+ PI L V + +V + L+NT L+LVY A LP V L+ F R Sbjct: 129 RALNFFIAIGIMIPIRLGTVSILQLVVALDLINTRTALVLVYTAQGLPLAVMILSEFMRQ 188 Query: 194 LPSSVAEAAFVDGASHTRTFFQIMLPMAKPGLISVGIFNFLGQWNQYMLPTVLNTDPDKR 253 +P + +AA DG FF+++LP+ +P + +V +F + WN P +L D R Sbjct: 189 IPGELKDAARCDGVGELSIFFRVILPLLRPAIATVAVFTMIPAWNDLWFPLILAPGEDTR 248 Query: 254 VLTQGLVQLAVSQGYKGDWSGLFAGLVMAMLPVLAAYIIFQRQVVQGLTAGALK 307 +T G VQ + Q Y DW+ + A L MA++PVL Y+ F RQ+++GLT+GA+K Sbjct: 249 TVTLG-VQQFIGQ-YATDWNSVLAALSMAVIPVLLLYMAFSRQLIRGLTSGAVK 300 Lambda K H 0.326 0.141 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 267 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 300 Length adjustment: 27 Effective length of query: 280 Effective length of database: 273 Effective search space: 76440 Effective search space used: 76440 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory