Align 2-dehydro-3-deoxy-D-gluconate-6-phosphate aldolase (EC 4.1.2.55) (characterized)
to candidate HSERO_RS05525 HSERO_RS05525 ketohydroxyglutarate aldolase
Query= metacyc::MONOMER-15645 (213 letters) >FitnessBrowser__HerbieS:HSERO_RS05525 Length = 209 Score = 225 bits (574), Expect = 4e-64 Identities = 112/205 (54%), Positives = 147/205 (71%), Gaps = 1/205 (0%) Query: 5 KTSAEQILTAGPVVPVIVINKLEHAVPMAKALVAGGVRVLELTLRTECAVEAIRLIAQEV 64 KT+ E I+ A PV+PVI I+K EHAVP+A+ALVAGG+RVLE+TLRTE + AIR IA+ V Sbjct: 2 KTTLE-IMRASPVIPVIAIDKFEHAVPLARALVAGGIRVLEITLRTEHGLPAIRAIAESV 60 Query: 65 PDAIVGAGTVTNPQQLAEVTAAGAQFAISPGLTEPLLKAATEGTIPLIPGISTVSELMLG 124 PDAIVG GT+T+P++ AGA F +SPGLT L++AA +PL+PG+ T SE+M Sbjct: 61 PDAIVGVGTLTSPEEFTASRDAGAVFGVSPGLTPALIEAAKRSGLPLLPGVMTPSEVMAA 120 Query: 125 MDYGLREFKFFPAEANGGVKALQAIAGPFGKIRFCPTGGISLKNYRDYLALKSVLCVGGS 184 + G R+ K FPA GGV L IAGP + FCPTGGI+ + +LA K+V+CVGGS Sbjct: 121 REAGFRQLKLFPAVPAGGVGMLNGIAGPLADVSFCPTGGITQETAPQFLACKNVVCVGGS 180 Query: 185 WLVPADALESGDYDRITALAREAVA 209 WL P A+E+GD+D+IT +A+ A A Sbjct: 181 WLTPKAAIEAGDWDKITEIAKAASA 205 Lambda K H 0.318 0.135 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 193 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 213 Length of database: 209 Length adjustment: 21 Effective length of query: 192 Effective length of database: 188 Effective search space: 36096 Effective search space used: 36096 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory